SUSE-SU-2019:2756-1

Source
https://www.suse.com/support/update/announcement/2019/suse-su-20192756-1/
Import Source
https://ftp.suse.com/pub/projects/security/osv/SUSE-SU-2019:2756-1.json
JSON Data
https://api.test.osv.dev/v1/vulns/SUSE-SU-2019:2756-1
Upstream
  • CVE-2019-15222
  • CVE-2019-15290
Related
Published
2019-10-23T15:01:48Z
Modified
2026-01-30T01:59:21.263079Z
Summary
Security update for the Linux Kernel
Details

The SUSE Linux Enterprise 12 SP4 RT kernel was updated to receive various security and bugfixes.

The following security bugs were fixed:

  • CVE-2019-15291: There was a NULL pointer dereference caused by a malicious USB device in the flexcopusbprobe function in the drivers/media/usb/b2c2/flexcop-usb.c driver (bnc#1146540).
  • CVE-2019-14821: An out-of-bounds access issue was found in the way Linux kernel's KVM hypervisor implements the coalesced MMIO write operation. It operates on an MMIO ring buffer 'struct kvmcoalescedmmio' object, wherein write indices 'ring->first' and 'ring->last' value could be supplied by a host user-space process. An unprivileged host user or process with access to '/dev/kvm' device could use this flaw to crash the host kernel, resulting in a denial of service or potentially escalating privileges on the system (bnc#1151350).
  • CVE-2017-18595: A double free may be caused by the function allocatetracebuffer in the file kernel/trace/trace.c (bnc#1149555).
  • CVE-2019-9506: The Bluetooth BR/EDR specification up to and including version 5.1 permitted sufficiently low encryption key length and did not prevent an attacker from influencing the key length negotiation. This allowed practical brute-force attacks (aka 'KNOB') that could decrypt traffic and injected arbitrary ciphertext without the victim noticing (bnc#1137865 bnc#1146042).
  • CVE-2019-14835: A buffer overflow flaw was found in the way Linux kernel's vhost functionality that translates virtqueue buffers to IOVs, logged the buffer descriptors during migration. A privileged guest user able to pass descriptors with invalid length to the host when migration is underway, could have used this flaw to increase their privileges on the host (bnc#1150112).
  • CVE-2019-15216: There was a NULL pointer dereference caused by a malicious USB device in the drivers/usb/misc/yurex.c driver (bnc#1146361).
  • CVE-2019-15924: fm10kinitmodule in drivers/net/ethernet/intel/fm10k/fm10kmain.c had a NULL pointer dereference because there was no -ENOMEM upon an allocworkqueue failure (bnc#1149612).
  • CVE-2019-9456: In the Pixel C USB monitor driver there was a possible OOB write due to a missing bounds check. This could have led to local escalation of privilege with System execution privileges needed. User interaction is not needed for exploitation (bnc#1150025).
  • CVE-2019-15031: In the Linux kernel on the powerpc platform, a local user could have read vector registers of other users' processes via an interrupt. To exploit the vulnerability, a local user starts a transaction (via the hardware transactional memory instruction tbegin) and then accesses vector registers. At some point, the vector registers will be corrupted with the values from a different local Linux process, because MSRTMACTIVE was misused in arch/powerpc/kernel/process.c (bnc#1149713).
  • CVE-2019-15030: In the Linux kernel on the powerpc platform, a local user could have read vector registers of other users' processes via a Facility Unavailable exception. To exploit the venerability, a local user starts a transaction (via the hardware transactional memory instruction tbegin) and then accesses vector registers. At some point, the vector registers will be corrupted with the values from a different local Linux process because of a missing arch/powerpc/kernel/process.c check (bnc#1149713).
  • CVE-2019-15920: SMB2_read in fs/cifs/smb2pdu.c had a use-after-free. (bnc#1149626).
  • CVE-2019-15921: There was a memory leak issue when idralloc() fails in genlregister_family() in net/netlink/genetlink.c (bnc#1149602).
  • CVE-2018-21008: A use-after-free could have been caused by the function rsimac80211detach in the file drivers/net/wireless/rsi/rsi91xmac80211.c (bnc#1149591).
  • CVE-2019-15919: SMB2_write in fs/cifs/smb2pdu.c had a use-after-free (bnc#1149552).
  • CVE-2019-15917: There was a use-after-free issue when hciuartregisterdev() fails in hciuartsetproto() in drivers/bluetooth/hci_ldisc.c (bnc#1149539).
  • CVE-2019-15926: An out-of-bounds access existed in the functions ath6klwmipstreamtimeouteventrx and ath6klwmicacevent_rx in the file drivers/net/wireless/ath/ath6kl/wmi.c (bnc#1149527).
  • CVE-2019-15927: An out-of-bounds access existed in the function buildaudioprocunit in the file sound/usb/mixer.c (bnc#1149522).
  • CVE-2019-15902: Misuse of the upstream 'x86/ptrace: Fix possible spectre-v1 in ptracegetdebugreg()' commit reintroduced the Spectre vulnerability that it aimed to eliminate. This occurred because the backport process depends on cherry picking specific commits, and because two (correctly ordered) code lines were swapped (bnc#1149376).
  • CVE-2019-15666: There was an out-of-bounds array access in _xfrmpolicyunlink, which will cause denial of service, because verifynewpolicyinfo in net/xfrm/xfrmuser.c mishandled directory validation (bnc#1148394).
  • CVE-2019-15219: There was a NULL pointer dereference caused by a malicious USB device in the drivers/usb/misc/sisusbvga/sisusb.c driver (bnc#1146524).
  • CVE-2019-14814: There was a heap-based buffer overflow in the Marvell wifi chip driver, that allowed local users to cause a denial of service (system crash) or possibly execute arbitrary code (bnc#1146512).
  • CVE-2019-14815: There was a heap-based buffer overflow in the Marvell wifi chip driver, that allowed local users to cause a denial of service (system crash) or possibly execute arbitrary code. (bsc#1146514)
  • CVE-2019-14816: There was a heap-based buffer overflow in the Marvell wifi chip driver, that allowed local users to cause a denial of service (system crash) or possibly execute arbitrary code (bnc#1146516).
  • CVE-2019-15220: There was a use-after-free caused by a malicious USB device in the drivers/net/wireless/intersil/p54/p54usb.c driver (bnc#1146526).
  • CVE-2019-15538: An issue was discovered in xfssetattrnonsize in fs/xfs/xfsiops.c in the Linux kernel XFS partially wedges when a chgrp fails on account of being out of disk quota. xfssetattrnonsize is failing to unlock the ILOCK after the xfsqmvopchown_reserve call fails. This is primarily a local DoS attack vector, but it might result as well in remote DoS if the XFS filesystem is exported for instance via NFS (bnc#1148093).
    • Update reference for ath6kl fix (CVE-2019-15290,bsc#1146543).
  • CVE-2019-15098: drivers/net/wireless/ath/ath6kl/usb.c had a NULL pointer dereference via an incomplete address in an endpoint descriptor (bnc#1146378).
  • CVE-2019-15239: An incorrect backport of a certain net/ipv4/tcpoutput.c fix allowed a local attacker to trigger multiple use-after-free conditions. This could result in a kernel crash, or potentially in privilege escalation. (bsc#1146589)
  • CVE-2019-15212: There was a double-free caused by a malicious USB device in the drivers/usb/misc/rio500.c driver (bnc#1146391).
  • CVE-2019-15292: There was a use-after-free in atalkprocexit, related to net/appletalk/atalkproc.c, net/appletalk/ddp.c, and net/appletalk/sysctlnetatalk.c (bnc#1146678).
  • CVE-2019-15217: There was a NULL pointer dereference caused by a malicious USB device in the drivers/media/usb/zr364xx/zr364xx.c driver (bnc#1146547).
  • CVE-2019-15211: There was a use-after-free caused by a malicious USB device in the drivers/media/v4l2-core/v4l2-dev.c driver because drivers/media/radio/radio-raremono.c did not properly allocate memory (bnc#1146519).
  • CVE-2019-15214: There was a use-after-free in the sound subsystem because card disconnection causes certain data structures to be deleted too early. This is related to sound/core/init.c and sound/core/info.c (bnc#1146550).
  • CVE-2019-15221: There was a NULL pointer dereference caused by a malicious USB device in the sound/usb/line6/pcm.c driver (bnc#1146529).
  • CVE-2019-15222: There was a NULL pointer dereference caused by a malicious USB device in the sound/usb/helper.c (motumicrobookii) driver (bnc#1146531).
  • CVE-2019-15218: There was a NULL pointer dereference caused by a malicious USB device in the drivers/media/usb/siano/smsusb.c driver (bnc#1146413).
  • CVE-2019-15215: There was a use-after-free caused by a malicious USB device in the drivers/media/usb/cpia2/cpia2usb.c driver (bnc#1146425).
  • CVE-2019-15090: An issue was discovered in drivers/scsi/qedi/qedidbg.c in the qedidbg* family of functions, there is an out-of-bounds read (bnc#1146399).
  • CVE-2018-20976: An issue was discovered in fs/xfs/xfssuper.c. A use after free exists, related to xfsfsfillsuper failure (bnc#1146285).
  • CVE-2017-18551: An issue was discovered in drivers/i2c/i2c-core-smbus.c. There was an out of bounds write in the function i2csmbusxferemulated (bnc#1146163).
  • CVE-2019-15118: checkinputterm in sound/usb/mixer.c mishandled recursion, leading to kernel stack exhaustion (bnc#1145922).
  • CVE-2019-15117: parseaudiomixerunit in sound/usb/mixer.c mishandled a short descriptor, leading to out-of-bounds memory access (bnc#1145920).
  • CVE-2019-11479: Fixed the default MSS that was hard-coded to 48 bytes. This allowed a remote peer to fragment TCP resend queues significantly more than if a larger MSS were enforced. A remote attacker could use this to cause a denial of service. (bnc#1137586).
  • CVE-2019-10207: Bluetooth/hciuart was missing a check for tty operations (bsc#1142857).
The following non-security bugs were fixed:

  • 6lowpan: Off by one handling ->nexthdr (bsc#1051510).
  • 9p: acl: fix uninitialized iattr access (bsc#1051510).
  • 9p: p9direntread: check network-provided name length (bsc#1051510).
  • 9p: pass the correct prototype to readcachepage (bsc#1051510).
  • 9p/rdma: do not disconnect on downinterruptible EAGAIN (bsc#1051510).
  • 9p/rdma: remove useless check in cmeventhandler (bsc#1051510).
  • 9p/virtio: Add cleanup path in p9virtioinit (bsc#1051510).
  • 9p/xen: Add cleanup path in p9transxeninit (bsc#1051510).
  • 9p/xen: fix check for xenbusread error in frontprobe (bsc#1051510).
  • Abort fileremoveprivs() for non-reg. files (bsc#1140888).
  • ACPI: Add Hygon Dhyana support ().
  • ACPI/arm64: ignore 5.1 FADTs that are reported as 5.0 (bsc#1051510).
  • ACPICA: Increase total number of possible Owner IDs (bsc#1148859).
  • ACPICA: Increase total number of possible Owner IDs (bsc#1148859).
  • ACPI: custommethod: fix memory leaks (bsc#1051510).
  • ACPI: fix false-positive -Wuninitialized warning (bsc#1051510).
  • ACPI: fix menuconfig presentation of ACPI submenu (bsc#1117158).
  • ACPI/IORT: Fix off-by-one check in iortdevfinditsid() (bsc#1051510).
  • ACPI/nfit: Always dump DSM output payload (bsc#1142351).
  • ACPI/PCI: fix acpipciirqenable() memory leak (bsc#1051510).
  • ACPI: PM: Allow transitions to D0 to occur in special cases (bsc#1051510).
  • ACPI: PM: Avoid evaluating PS3 on transitions from D3hot to D3cold (bsc#1051510).
  • ACPI: PM: Fix regression in acpidevicesetpower() (bsc#1051510).
  • ACPI / property: Fix acpigraphgetremoteendpoint() name in kerneldoc (bsc#1051510).
  • ACPI / property: fix handling of datanodes in acpigetnextsubnode() (bsc#1051510).
  • Add back sibling paca poiter to paca (bsc#1055117).
  • Added De0-Nanos-SoC board support (and others based on Altera SOC).
  • Add missing structs and defines from recent SMB3.1.1 documentation (bsc#1144333).
  • Add new flag on SMB3.1.1 read (bsc#1144333).
  • Address lock imbalance warnings in smbdirect.c (bsc#1144333).
  • Add sample kernel-default-base spec file (jsc#SLE-4117, jsc#SLE-3853, bsc#1128910).
  • Add some missing debug fields in server and tcon structs (bsc#1144333).
  • add some missing definitions (bsc#1144333).
  • Add support for crct10dif-vpmsum ().
  • Add vers=3.0.2 as a valid option for SMBv3.0.2 (bsc#1144333).
  • afkey: fix leaks in keypolgetresp and dumpsp (bsc#1051510).
  • afkey: unconditionally clone on broadcast (bsc#1051510).
  • afpacket: Block execution of tasks waiting for transmit to complete in AFPACKET (networking-stable-190702).
  • afunix: remove redundant lockdep class (git-fixes).
  • ALSA: aoa: onyx: always initialize register read value (bsc#1051510).
  • ALSA: compress: Be more restrictive about when a drain is allowed (bsc#1051510).
  • ALSA: compress: Do not allow paritial drain operations on capture streams (bsc#1051510).
  • ALSA: compress: Fix regression on compressed capture streams (bsc#1051510).
  • ALSA: compress: Prevent bypasses of setparams (bsc#1051510).
  • ALSA: firewire: fix a memory leak bug (bsc#1051510).
  • ALSA: firewire-lib/fireworks: fix miss detection of received MIDI messages (bsc#1051510).
  • ALSA: firewire-motu: fix destruction of data for isochronous resources (bsc#1051510).
  • ALSA: firewire-tascam: check intermediate state of clock status and retry (bsc#1051510).
  • ALSA: firewire-tascam: handle error code when getting current source of clock (bsc#1051510).
  • ALSA: hda - Add a conexant codec entry to let mute led work (bsc#1051510).
  • ALSA: hda - Add a generic rebootnotify (bsc#1051510).
  • ALSA: hda - Apply workaround for another AMD chip 1022:1487 (bsc#1051510).
  • ALSA: hda - Do not override global PCM hw info flag (bsc#1051510).
  • ALSA: hda - Fix a memory leak bug (bsc#1051510).
  • ALSA: hda - Fix potential endless loop at applying quirks (bsc#1051510).
  • ALSA: hda - Force polling mode on CNL for fixing codec communication (bsc#1051510).
  • ALSA: hda: kabi workaround for generic parser flag (bsc#1051510).
  • ALSA: hda - Let all conexant codec enter D3 when rebooting (bsc#1051510).
  • ALSA: hda/realtek: Add quirks for several Clevo notebook barebones (bsc#1051510).
  • ALSA: hda/realtek: apply ALC891 headset fixup to one Dell machine (bsc#1051510).
  • ALSA: hda/realtek - Change front mic location for Lenovo M710q (bsc#1051510).
  • ALSA: hda/realtek - Fixed Headphone Mic can't record on Dell platform (bsc#1051510).
  • ALSA: hda/realtek - Fix overridden device-specific initialization (bsc#1051510).
  • ALSA: hda/realtek - Fix the problem of two front mics on a ThinkCentre (bsc#1051510).
  • ALSA: hda/realtek - Headphone Mic can't record after S3 (bsc#1051510).
  • ALSA: hda/realtek - Set default power save node to 0 (bsc#1051510).
  • ALSA: hda/realtek - Update headset mode for ALC256 (bsc#1051510).
  • ALSA: hda - Workaround for crackled sound on AMD controller (1022:1457) (bsc#1051510).
  • ALSA: hiface: fix multiple memory leak bugs (bsc#1051510).
  • ALSA: line6: Fix a typo (bsc#1051510).
  • ALSA: line6: Fix memory leak at line6initpcm() error path (bsc#1051510).
  • ALSA: line6: Fix write on zero-sized buffer (bsc#1051510).
  • ALSA: line6: Fix wrong altsetting for LINE6PODHD5001 (bsc#1051510).
  • ALSA: oxfw: allow PCM capture for Stanton SCS.1m (bsc#1051510).
  • ALSA: pcm: fix lost wakeup event scenarios in sndpcmdrain (bsc#1051510).
  • ALSA: seq: Break too long mutex context in the write loop (bsc#1051510).
  • ALSA: seq: fix incorrect order of destclient/destports arguments (bsc#1051510).
  • ALSA: seq: Fix potential concurrent access to the deleted pool (bsc#1051510).
  • ALSA: usb-audio: Add quirk for Focusrite Scarlett Solo (bsc#1051510).
  • ALSA: usb-audio: Add quirk for MOTU MicroBook II (bsc#1051510).
  • ALSA: usb-audio: Cleanup DSD whitelist (bsc#1051510).
  • ALSA: usb-audio: Enable .productname override for Emagic, Unitor 8 (bsc#1051510).
  • ALSA: usb-audio: Fix gpf in sndusbpipesanitycheck (bsc#1051510).
  • ALSA: usb-audio: fix sign unintended sign extension on left shifts (bsc#1051510).
  • ALSA: usb-audio: Sanity checks for each pipe and EP types (bsc#1051510).
  • apparmor: enforce nullbyte at end of tag string (bsc#1051510).
  • arch: arm64: acpi: KABI ginore includes (bsc#1117158 bsc#1134671).
  • arm64: acpi: fix alignment fault in accessing ACPI (bsc#1117158).
  • arm64: fix ACPI dependencies (bsc#1117158).
  • arm64: KVM: Fix architecturally invalid reset value for FPEXC32EL2 (bsc#1133021).
  • arm64, mm, efi: Account for GICv3 LPI tables in static memblock reserve table (bsc#1117158).
  • ARM: KVM: Add SMCCCARCHWORKAROUND1 fast handling (bsc#1133021).
  • ARM: KVM: report support for SMCCCARCHWORKAROUND1 (bsc#1133021).
  • ASoC : cs4265 : readable register too low (bsc#1051510).
  • ASoC: cs42xx8: Add regcache mask dirty (bsc#1051510).
  • ASoC: cx2072x: fix integer overflow on unsigned int multiply (bsc#1111666).
  • ASoC: dapm: Fix handling of customstopcondition on DAPM graph walks (bsc#1051510).
  • ASoC: es8328: Fix copy-paste error in es8328rightlinecontrols (bsc#1051510).
  • ASoC: eukrea-tlv320: fix a leaked reference by adding missing ofnodeput (bsc#1051510).
  • ASoC: Fail card instantiation if DAI format setup fails (bsc#1051510).
  • ASoC: fslasrc: Fix the issue about unsupported rate (bsc#1051510).
  • ASoC: fslsai: Update isslavemode with correct value (bsc#1051510).
  • ASoC: fslutils: fix a leaked reference by adding missing ofnodeput (bsc#1051510).
  • ASoC: hdmi-codec: unlock the device on startup errors (bsc#1051510).
  • ASoC: Intel: Baytrail: Fix implicit fallthrough warning (bsc#1051510).
  • ASoC: max98090: remove 24-bit format support if RJ is 0 (bsc#1051510).
  • ASoC: soc-pcm: BE dai needs prepare when pause release after resume (bsc#1051510).
  • ASoC: sun4i-i2s: RX and TX counter registers are swapped (bsc#1051510).
  • ASoC: wm8737: Fix copy-paste error in wm8737sndcontrols (bsc#1051510).
  • ASoC: wm8988: fix typo in wm8988rightlinecontrols (bsc#1051510).
  • ata: libahci: do not complain in case of deferred probe (bsc#1051510).
  • ath6kl: add some bounds checking (bsc#1051510).
  • ath9k: dynack: fix possible deadlock in athdynacknode{de}init (bsc#1051510).
  • atm: iphase: Fix Spectre v1 vulnerability (networking-stable-190808).
  • audit: fix a memory leak bug (bsc#1051510).
  • ax25: fix inconsistent lock state in ax25destroytimer (bsc#1051510).
  • batman-adv: allow updating DAT entry timeouts on incoming ARP Replies (bsc#1051510).
  • batman-adv: fix for leaked TVLV handler (bsc#1051510).
  • batman-adv: fix uninit-value in batadvnetlinkgetifindex() (bsc#1051510).
  • batman-adv: Only read OGM2 tvlvlen after buffer len check (bsc#1051510).
  • batman-adv: Only read OGM tvlvlen after buffer len check (bsc#1051510).
  • bcache: acquire bchregisterlock later in cacheddevdetachfinish() (bsc#1140652).
  • bcache: acquire bchregisterlock later in cacheddevfree() (bsc#1140652).
  • bcache: add code comments for journalreadbucket() (bsc#1140652).
  • bcache: Add comments for blkdevput() in registration code path (bsc#1140652).
  • bcache: add comments for closurefn to be called in closurequeue() (bsc#1140652).
  • bcache: add comments for kobj release callback routine (bsc#1140652).
  • bcache: add comments for mutexlock(&b->writelock) (bsc#1140652).
  • bcache: add error check for calling registerbdev() (bsc#1140652).
  • bcache: add failure check to runcacheset() for journal replay (bsc#1140652).
  • bcache: add io error counting in writebdevsuperendio() (bsc#1140652).
  • bcache: add more error message in bchcacheddevattach() (bsc#1140652).
  • bcache: add pendingscleanup to stop pending bcache device (bsc#1140652).
  • bcache: add reclaimedjournalbuckets to struct cacheset (bsc#1140652).
  • bcache: add return value check to bchcacheddevrun() (bsc#1140652).
  • bcache: avoid a deadlock in bcachereboot() (bsc#1140652).
  • bcache: avoid clang -Wunintialized warning (bsc#1140652).
  • bcache: avoid flushing btree node in cachesetflush() if io disabled (bsc#1140652).
  • bcache: avoid potential memleak of list of journalreplay(s) in the CACHESYNC branch of runcacheset (bsc#1140652).
  • bcache: check CACHESETIODISABLE bit in bchjournal() (bsc#1140652).
  • bcache: check CACHESETIODISABLE in allocator code (bsc#1140652).
  • bcache: check c->gcthread by ISERRORNULL in cachesetflush() (bsc#1140652).
  • bcache: Clean up bchgetcongested() (bsc#1140652).
  • bcache: destroy dc->writebackwritewq if failed to create dc->writebackthread (bsc#1140652).
  • bcache: do not assign in if condition in bcachedeviceinit() (bsc#1140652).
  • bcache: do not set max writeback rate if gc is running (bsc#1140652).
  • bcache: fix a race between cache register and cacheset unregister (bsc#1140652).
  • bcache: fix crashes stopping bcache device before read miss done (bsc#1140652).
  • bcache: fix failure in journal relplay (bsc#1140652).
  • bcache: fix inaccurate result of unused buckets (bsc#1140652).
  • bcache: fix mistaken sysfs entry for ioerror counter (bsc#1140652).
  • bcache: fix possible memory leak in bchcacheddevrun() (git fixes).
  • bcache: fix potential deadlock in cacheddeffree() (bsc#1140652).
  • bcache: fix race in btreeflushwrite() (bsc#1140652).
  • bcache: fix return value error in bchjournalread() (bsc#1140652).
  • bcache: fix stack corruption by PRECEDINGKEY() (bsc#1140652).
  • bcache: fix wrong usage use-after-freed on keylist in outnocoalesce branch of btreegccoalesce (bsc#1140652).
  • bcache: ignore read-ahead request failure on backing device (bsc#1140652).
  • bcache: improve bcachereboot() (bsc#1140652).
  • bcache: improve error message in bchcacheddevrun() (bsc#1140652).
  • bcache: make bsetsearchtree() be more understandable (bsc#1140652).
  • bcache: make isdiscardenabled() static (bsc#1140652).
  • bcache: more detailed error message to bcachedevicelink() (bsc#1140652).
  • bcache: move definition of 'int ret' out of macro readbucket() (bsc#1140652).
  • bcache: never set KEYPTRS of journal key to 0 in journalreclaim() (bsc#1140652).
  • bcache: only clear BTREENODEdirty bit when it is set (bsc#1140652).
  • bcache: only set BCACHEDEVWBRUNNING when cached device attached (bsc#1140652).
  • bcache: performance improvement for btreeflushwrite() (bsc#1140652).
  • bcache: remove redundant LISTHEAD(journal) from runcacheset() (bsc#1140652).
  • bcache: remove retryflushwrite from struct cacheset (bsc#1140652).
  • bcache: remove unncessary code in bchbtreekeysinit() (bsc#1140652).
  • bcache: remove unnecessary prefetch() in bsetsearchtree() (bsc#1140652).
  • bcache: remove 'XXX:' comment line from runcacheset() (bsc#1140652).
  • bcache: return error immediately in bchjournalreplay() (bsc#1140652).
  • bcache: Revert 'bcache: fix high CPU occupancy during journal' (bsc#1140652).
  • bcache: Revert 'bcache: free heap cacheset->flushbtree in bchjournalfree' (bsc#1140652).
  • bcache: set largest seq to ja->seq[bucketindex] in journalreadbucket() (bsc#1140652).
  • bcache: shrink btree node cache after bchbtreecheck() (bsc#1140652).
  • bcache: stop writeback kthread and kworker when bchcacheddevrun() failed (bsc#1140652).
  • bcache: use sysfsmatchstring() instead of sysfsmatchstring() (bsc#1140652).
  • bcma: fix incorrect update of BCMACOREPCIMDIODATA (bsc#1051510).
  • be2net: Fix number of Rx queues used for flow hashing (networking-stable-190618).
  • be2net: Signal that the device cannot transmit during reconfiguration (bsc#1127315).
  • be2net: Synchronize beupdatequeues with devwatchdog (bsc#1127315).
  • bio: fix improper use of smpmbbeforeatomic() (git fixes).
  • blk-flush: do not run queue for requests bypassing flush (bsc#1137959).
  • blk-flush: use blkmqrequestbypassinsert() (bsc#1137959).
  • blk-mq: backport fixes for blkmqcompleteerequestsync() (bsc#1145661).
  • blk-mq: do not allocate driver tag upfront for flush rq (bsc#1137959).
  • blk-mq: fix hang caused by freeze/unfreeze sequence (bsc#1128432).
  • blk-mq: Fix memory leak in blkmqinitallocatedqueue error handling (bsc#1151610).
  • blk-mq: Fix spelling in a source code comment (git fixes).
  • blk-mq: free hw queue's resource in hctx's release handler (bsc#1140637).
  • blk-mq: insert rq with DONTPREP to hctx dispatch list when requeue (bsc#1137959).
  • blk-mq: introduce blkmqcompleterequestsync() (bsc#1145661).
  • blk-mq: kABI fixes for blk-mq.h (bsc#1137959).
  • blk-mq: move blkmqputdrivertag() into blk-mq.h (bsc#1137959).
  • blk-mq: punt failed direct issue to dispatch list (bsc#1137959).
  • blk-mq: put the driver tag of nxt rq before first one is requeued (bsc#1137959).
  • blk-mq-sched: decide how to handle flush rq via RQFFLUSHSEQ (bsc#1137959).
  • blk-wbt: Avoid lock contention and thundering herd issue in wbt_wait (bsc#1141543).
  • blk-wbt: Avoid lock contention and thundering herd issue in wbt_wait (bsc#1141543).
  • block, bfq: NULL out the bic when it's no longer valid (bsc#1142359).
  • block, documentation: Fix wbtlatusec documentation (git fixes).
  • block: Fix a NULL pointer dereference in genericmakerequest() (bsc#1139771).
  • block: fix timeout changes for legacy request drivers (bsc#1149446).
  • block: kABI fixes for BLKEHDONE renaming (bsc#1142076).
  • block: rename BLKEHNOTHANDLED to BLKEH_DONE (bsc#1142076).
  • Bluetooth: 6lowpan: search for destination address in all peers (bsc#1051510).
  • Bluetooth: Add SMP workaround Microsoft Surface Precision Mouse bug (bsc#1051510).
  • Bluetooth: btqca: Add a short delay before downloading the NVM (bsc#1051510).
  • Bluetooth: Check state in l2capdisconnectrsp (bsc#1051510).
  • Bluetooth: Fix faulty expression for minimum encryption key size check (bsc#1140328).
  • Bluetooth: hcibcsp: Fix memory leak in rxskb (bsc#1051510).
  • Bluetooth: validate BLE connection interval updates (bsc#1051510).
  • bnx2x: Disable multi-cos feature (networking-stable-190808).
  • bnx2x: Prevent load reordering in tx completion processing (bsc#1142868).
  • bnx2x: Prevent ptptask to be rescheduled indefinitely (networking-stable-1907_25).
  • bnxten: Fix aggregation buffer leak under OOM condition (networking-stable-1905_31).
  • bonding/802.3ad: fix linkfailurecount tracking (bsc#1137069 bsc#1141013).
  • bonding/802.3ad: fix slave link initialization transition states (bsc#1137069 bsc#1141013).
  • bonding: Add vlan tx offload to hwencfeatures (networking-stable-190821).
  • bonding: Always enable vlan tx offload (networking-stable-190702).
  • bonding: fix arpvalidate toggling in active-backup mode (networking-stable-1905_14).
  • bonding: Force slave speed check after link state recovery for 802.3ad (bsc#1137584).
  • bonding: set default miimon value for non-arp modes if not set (bsc#1137069 bsc#1141013).
  • bonding: speed/duplex update at NETDEV_UP event (bsc#1137069 bsc#1141013).
  • bonding: validate ip header before check IPPROTOIGMP (networking-stable-1907_25).
  • bpf, x64: fix stack layout of JITed bpf code (bsc#1083647).
  • bpf, x64: save 5 bytes in prologue when ebpf insns came from cbpf (bsc#1083647).
  • brcmfmac: convert devinitlock mutex to completion (bsc#1051510).
  • brcmfmac: fix missing checks for kmemdup (bsc#1051510).
  • brcmfmac: fix Oops when bringing up interface during USB disconnect (bsc#1051510).
  • brcmfmac: fix race during disconnect when USB completion is in progress (bsc#1051510).
  • brcmfmac: fix WARNING during USB disconnect in case of unempty psq (bsc#1051510).
  • bridge: Fix error path for kobjectinitandadd() (networking-stable-1905_14).
  • btrfs: add a helper to retrive extent inline ref type (bsc#1149325).
  • btrfs: add cleanuprefhead_accounting helper (bsc#1050911).
  • btrfs: add missing inode version, ctime and mtime updates when punching hole (bsc#1140487).
  • btrfs: add one more sanity check for shared ref type (bsc#1149325).
  • btrfs: clean up pending block groups when transaction commit aborts (bsc#1050911).
  • btrfs: convert to use btrfsgetextentinlineref_type (bsc#1149325).
  • btrfs: do not abort transaction at btrfsupdateroot() after failure to COW path (bsc#1150933).
  • btrfs: fix assertion failure during fsync and use of stale transaction (bsc#1150562).
  • btrfs: fix data loss after inode eviction, renaming it, and fsync it (bsc#1145941).
  • btrfs: Fix delalloc inodes invalidation during transaction abort (bsc#1050911).
  • btrfs: fix fsync not persisting dentry deletions due to inode evictions (bsc#1145942).
  • btrfs: fix incremental send failure after deduplication (bsc#1145940).
  • btrfs: fix pinned underflow after transaction aborted (bsc#1050911).
  • btrfs: fix race between block group removal and block group allocation (bsc#1143003).
  • btrfs: fix race between send and deduplication that lead to failures and crashes (bsc#1145059).
  • btrfs: fix race leading to fs corruption after transaction abort (bsc#1145937).
  • btrfs: fix use-after-free when using the tree modification log (bsc#1151891).
  • btrfs: handle delayed ref head accounting cleanup in abort (bsc#1050911).
  • btrfs-kill-btrfsclearpath_blocking.patch: (bsc#1140139).
  • btrfs: prevent send failures and crashes due to concurrent relocation (bsc#1145059).
  • btrfs: qgroup: Fix reserved data space leak if we have multiple reserve calls (bsc#1152975).
  • btrfs: qgroup: Fix the wrong target io_tree when freeing reserved data space (bsc#1152974).
  • btrfs: relocation: fix use-after-free on dead relocation roots (bsc#1152972).
  • btrfs: remove BUG() in adddatareference (bsc#1149325).
  • btrfs: remove BUG() in btrfsextentinlinerefsize (bsc#1149325).
  • btrfs: remove BUG() in printextentitem (bsc#1149325).
  • btrfs: remove BUGON in _addtreeblock (bsc#1149325).
  • btrfs: scrub: add memallocnofs protection around initipath (bsc#1086103).
  • btrfs: Split btrfsdeldelalloc_inode into 2 functions (bsc#1050911).
  • btrfs: start readahead also in seed devices (bsc#1144886).
  • btrfs: track running balance in a simpler way (bsc#1145059).
  • btrfs: use GFPKERNEL in initipath (bsc#1086103).
  • Build klp-symbols in kernel devel projects.
  • caif-hsi: fix possible deadlock in cfhsiexitmodule() (networking-stable-190725).
  • can: afcan: Fix error path of caninit() (bsc#1051510).
  • can: flexcan: fix timeout when set small bitrate (bsc#1051510).
  • can: m_can: implement errata 'Needless activation of MRAF irq' (bsc#1051510).
  • can: mcp251x: add support for mcp25625 (bsc#1051510).
  • can: peakusb: fix potential double kfreeskb() (bsc#1051510).
  • can: peak_usb: force the string buffer NULL-terminated (bsc#1051510).
  • can: peakusb: pcanusb_fd: Fix info-leaks to USB devices (bsc#1051510).
  • can: peakusb: pcanusb_pro: Fix info-leaks to USB devices (bsc#1051510).
  • can: purge socket error queue on sock destruct (bsc#1051510).
  • can: rcar_canfd: fix possible IRQ storm on high load (bsc#1051510).
  • can: sja1000: force the string buffer NULL-terminated (bsc#1051510).
  • carl9170: fix misuse of device driver API (bsc#1142635).
  • ceph: always get rstat from auth mds (bsc#1146346).
  • ceph: clean up ceph.dir.pin vxattr name sizeof() (bsc#1146346).
  • ceph: decode feature bits in session message (bsc#1146346).
  • ceph: do not blindly unregister session that is in opening state (bsc#1148133).
  • ceph: do not try fill file_lock on unsuccessful GETFILELOCK reply (bsc#1148133).
  • ceph: fix buffer free while holding icephlock in _cephbuildxattrsblob() (bsc#1148133).
  • ceph: fix buffer free while holding icephlock in _cephsetxattr() (bsc#1148133).
  • ceph: fix buffer free while holding icephlock in fill_inode() (bsc#1148133).
  • ceph: fix 'ceph.dir.rctime' vxattr value (bsc#1148133 bsc#1135219).
  • ceph: fix improper use of smpmbbeforeatomic() (bsc#1148133).
  • ceph: flush dirty inodes before proceeding with remount (bsc#1140405).
  • ceph: hold icephlock when removing caps for freeing inode (bsc#1148133).
  • ceph: remove request from waiting list before unregister (bsc#1148133).
  • ceph: silence a checker warning in mdsc_show() (bsc#1148133).
  • ceph: support cephfs' own feature bits (bsc#1146346).
  • ceph: support getting ceph.dir.pin vxattr (bsc#1146346).
  • ceph: support versioned reply (bsc#1146346).
  • ceph: use bit flags to define vxattr attributes (bsc#1146346).
  • ceph: use cephevictinode to cleanup inode's resource (bsc#1148133).
  • cfg80211: fix memory leak of wiphy device name (bsc#1051510).
  • cgroup: Use csstryget() instead of csstrygetonline() in taskget_css() (bsc#1141478).
  • chardev: add additional check for minor range overlap (bsc#1051510).
  • cifs: Accept validate negotiate if server return NTSTATUSNOT_SUPPORTED (bsc#1144333).
  • cifs: add a new SMB2closeflags function (bsc#1144333).
  • cifs: add a smb2compoundop and change QUERY_INFO to use it (bsc#1144333).
  • cifs: add a timeout argument to waitforfree_credits (bsc#1144333).
  • cifs: add a warning if we try to to dequeue a deleted mid (bsc#1144333).
  • cifs: add compoundsendrecv() (bsc#1144333).
  • cifs: add credits from unmatched responses/messages (bsc#1144333).
  • cifs: add debug output to show nocase mount option (bsc#1144333).
  • cifs: Add DFS cache routines (bsc#1144333).
  • cifs: Add direct I/O functions to file_operations (bsc#1144333).
  • cifs: add fiemap support (bsc#1144333).
  • cifs: add iface info to struct cifs_ses (bsc#1144333).
  • cifs: add IOCTL for QUERY_INFO passthrough to userspace (bsc#1144333).
  • cifs: add lease tracking to the cached root fid (bsc#1144333).
  • cifs: Add minor debug message during negprot (bsc#1144333).
  • cifs: add missing debug entries for kconfig options (bsc#1051510, bsc#1144333).
  • cifs: add missing GCM module dependency (bsc#1144333).
  • cifs: add missing support for ACLs in SMB 3.11 (bsc#1051510, bsc#1144333).
  • cifs: add ONCE flag for cifs_dbg type (bsc#1144333).
  • cifs: add pdusize to the TCPServer_Info structure (bsc#1144333).
  • cifs: add respbufsize to the midqentry structure (bsc#1144333).
  • cifs: address trivial coverity warning (bsc#1144333).
  • cifs: add server argument to the dump_detail method (bsc#1144333).
  • cifs: add server->vals->headerpreamblesize (bsc#1144333).
  • cifs: add SFM mapping for 0x01-0x1F (bsc#1144333).
  • cifs: add sha512 secmech (bsc#1051510, bsc#1144333).
  • cifs: Adds information-level logging function (bsc#1144333).
  • cifs: add SMB2closeinit()/SMB2closefree() (bsc#1144333).
  • cifs: add SMB2ioctlinit/free helpers to be used with compounding (bsc#1144333).
  • cifs: add SMB2queryinfo_init|free (bsc#1144333).
  • cifs: Add smb2sendrecv (bsc#1144333).
  • cifs: add spinlock for the openFileList to cifsInodeInfo (bsc#1144333).
  • cifs: add .splice_write (bsc#1144333).
  • cifs: Add support for direct I/O read (bsc#1144333).
  • cifs: Add support for direct I/O write (bsc#1144333).
  • cifs: Add support for direct pages in rdata (bsc#1144333).
  • cifs: Add support for direct pages in wdata (bsc#1144333).
  • cifs: Add support for failover in cifs_mount() (bsc#1144333).
  • cifs: Add support for failover in cifs_reconnect() (bsc#1144333).
  • cifs: Add support for failover in cifsreconnecttcon() (bsc#1144333).
  • cifs: Add support for failover in smb2_reconnect() (bsc#1144333).
  • cifs: Add support for FSCTL passthrough that write data to the server (bsc#1144333).
  • cifs: add support for ioctl on directories (bsc#1144333).
  • cifs: Add support for reading attributes on SMB2+ (bsc#1051510, bsc#1144333).
  • cifs: add support for SEEKDATA and SEEKHOLE (bsc#1144333).
  • cifs: Add support for writing attributes on SMB2+ (bsc#1051510, bsc#1144333).
  • cifs: Adjust MTU credits before reopening a file (bsc#1144333).
  • cifs: Allocate memory for all iovs in smb2_ioctl (bsc#1144333).
  • cifs: Allocate validate negotiation request through kmalloc (bsc#1144333).
  • cifs: allow calling SMB2xxxfree(NULL) (bsc#1144333).
  • cifs: allow disabling less secure legacy dialects (bsc#1144333).
  • cifs: allow guest mounts to work for smb3.11 (bsc#1051510, bsc#1144333).
  • cifs: always add credits back for unsolicited PDUs (bsc#1144333).
  • cifs: Always reset read error to -EIO if no response (bsc#1144333).
  • cifs: Always resolve hostname before reconnecting (bsc#1051510, bsc#1144333).
  • cifs: a smb2validateandcopyiov failure does not mean the handle is invalid (bsc#1144333).
  • cifs: auto disable 'serverino' in dfs mounts (bsc#1144333).
  • cifs: avoid a kmalloc in smb2sendrecv/SendReceive2 for the common case (bsc#1144333).
  • cifs: Avoid returning EBUSY to upper layer VFS (bsc#1144333).
  • cifs: cache FILEALLINFO for the shared root handle (bsc#1144333).
  • cifs: Calculate the correct request length based on page offset and tail size (bsc#1144333).
  • cifs: Call MID callback before destroying transport (bsc#1144333).
  • cifs: change mkdir to use a compound (bsc#1144333).
  • cifs: change smb2getdataarealen to take a smb2synchdr as argument (bsc#1144333).
  • cifs: Change SMB2_open to return an iov for the error parameter (bsc#1144333).
  • cifs: change SMB2OPRENAME and SMB2OPHARDLINK to use compounding (bsc#1144333).
  • cifs: change SMB2OPSET_EOF to use compounding (bsc#1144333).
  • cifs: change SMB2OPSET_INFO to use compounding (bsc#1144333).
  • cifs: change smb2queryeas to use the compound query-info helper (bsc#1144333).
  • cifs: change unlink to use a compound (bsc#1144333).
  • cifs: change validatebuf to validateiov (bsc#1144333).
  • cifs: change waitforfree_request() to take flags as argument (bsc#1144333).
  • cifs: check CIFSMOUNTNO_DFS when trying to reuse existing sb (bsc#1144333).
  • cifs: Check for reconnects before sending async requests (bsc#1144333).
  • cifs: Check for reconnects before sending compound requests (bsc#1144333).
  • cifs: check for STATUSUSERSESSION_DELETED (bsc#1112902, bsc#1144333).
  • cifs: Check for timeout on Negotiate stage (bsc#1091171, bsc#1144333).
  • cifs: check if SMB2 PDU size has been padded and suppress the warning (bsc#1144333).
  • cifs: check kmalloc before use (bsc#1051510, bsc#1144333).
  • cifs: check kzalloc return (bsc#1144333).
  • cifs: check MaxPathNameComponentLength != 0 before using it (bsc#1085536, bsc#1144333).
  • cifs: check ntwrkbufstart for NULL before dereferencing it (bsc#1144333).
  • cifs: check rsp for NULL before dereferencing in SMB2_open (bsc#1085536, bsc#1144333).
  • cifs: cifsreadallocate_pages: do not iterate through whole page array on ENOMEM (bsc#1144333).
  • cifs: clean up indentation, replace spaces with tab (bsc#1144333).
  • cifs: cleanup smb2ops.c and normalize strings (bsc#1144333).
  • cifs: complete PDU definitions for interface queries (bsc#1144333).
  • cifs: connect to servername instead of IP for IPC$ share (bsc#1051510, bsc#1144333).
  • cifs: Count SMB3 credits for malformed pending responses (bsc#1144333).
  • cifs: create a define for how many iovs we need for an SMB2_open() (bsc#1144333).
  • cifs: create a define for the max number of iov we need for a SMB2 set_info (bsc#1144333).
  • cifs: create a helper function for compound query_info (bsc#1144333).
  • cifs: create helpers for SMB2setinfo_init/free() (bsc#1144333).
  • cifs: create SMB2openinit()/SMB2openfree() helpers (bsc#1144333).
  • cifs: Display SMB2 error codes in the hex format (bsc#1144333).
  • cifs: document tcon/ses/server refcount dance (bsc#1144333).
  • cifs: do not allow creating sockets except with SMB1 posix exensions (bsc#1102097, bsc#1144333).
  • cifs: Do not assume one credit for async responses (bsc#1144333).
  • cifs: do not attempt cifs operation on smb2+ rename error (bsc#1144333).
  • cifs: Do not consider -ENODATA as stat failure for reads (bsc#1144333).
  • cifs: Do not count -ENODATA as failure for query directory (bsc#1051510, bsc#1144333).
  • cifs: do not dereference smbfiletarget before null check (bsc#1051510, bsc#1144333).
  • cifs: Do not hide EINTR after sending network packets (bsc#1051510, bsc#1144333).
  • cifs: Do not log credits when unmounting a share (bsc#1144333).
  • cifs: do not log STATUSNOTFOUND errors for DFS (bsc#1051510, bsc#1144333).
  • cifs: Do not match port on SMBDirect transport (bsc#1144333).
  • cifs: Do not modify mid entry after submitting I/O in cifscallasync (bsc#1051510, bsc#1144333).
  • cifs: Do not reconnect TCP session in add_credits() (bsc#1051510, bsc#1144333).
  • cifs: Do not reset lease state to NONE on lease break (bsc#1051510, bsc#1144333).
  • cifs: do not return atime less than mtime (bsc#1144333).
  • cifs: do not send invalid input buffer on QUERY_INFO requests (bsc#1144333).
  • cifs: Do not set credits to 1 if the server didn't grant anything (bsc#1144333).
  • cifs: do not show domain= in mount output when domain is empty (bsc#1144333).
  • cifs: Do not skip SMB2 message IDs on send failures (bsc#1144333).
  • cifs: do not use _constantcputole32() (bsc#1144333).
  • cifs: dump every session iface info (bsc#1144333).
  • cifs: dump IPC tcon in debug proc file (bsc#1071306, bsc#1144333).
  • cifs: fallback to older infolevels on findfirst queryinfo retry (bsc#1144333).
  • cifs: Find and reopen a file before get MTU credits in writepages (bsc#1144333).
  • cifs: fix a buffer leak in smb2querysymlink (bsc#1144333).
  • cifs: fix a credits leak for compund commands (bsc#1144333).
  • cifs: Fix a debug message (bsc#1144333).
  • cifs: Fix adjustment of credits for MTU requests (bsc#1051510, bsc#1144333).
  • cifs: Fix an issue with re-sending rdata when transport returning -EAGAIN (bsc#1144333).
  • cifs: Fix an issue with re-sending wdata when transport returning -EAGAIN (bsc#1144333).
  • cifs: Fix a race condition with cifsechorequest (bsc#1144333).
  • cifs: Fix a tiny potential memory leak (bsc#1144333).
  • cifs: Fix autonegotiate security settings mismatch (bsc#1087092, bsc#1144333).
  • cifs: fix bi-directional fsctl passthrough calls (bsc#1144333).
  • cifs: fix build break when CONFIGCIFSDEBUG2 enabled (bsc#1144333).
  • cifs: fix build errors for SMB_DIRECT (bsc#1144333).
  • cifs: Fix check for matching with existing mount (bsc#1144333).
  • cifs: fix circular locking dependency (bsc#1064701, bsc#1144333).
  • cifs: fix computation for MAXSMB2HDR_SIZE (bsc#1144333).
  • cifs: fix confusing warning message on reconnect (bsc#1144333).
  • cifs: fix crash in cifsdfsdo_automount (bsc#1144333).
  • cifs: fix crash in smb2compoundop()/smb2setnext_command() (bsc#1144333).
  • cifs: fix crash querying symlinks stored as reparse-points (bsc#1144333).
  • cifs: Fix credit calculation for encrypted reads with errors (bsc#1051510, bsc#1144333).
  • cifs: Fix credit calculations in compound mid callback (bsc#1144333).
  • cifs: Fix credit computation for compounded requests (bsc#1144333).
  • cifs: Fix credits calculation for cancelled requests (bsc#1144333).
  • cifs: Fix credits calculations for reads with errors (bsc#1051510, bsc#1144333).
  • cifs: fix credits leak for SMB1 oplock breaks (bsc#1144333).
  • cifs: fix deadlock in cached root handling (bsc#1144333).
  • cifs: Fix DFS cache refresher for DFS links (bsc#1144333).
  • cifs: fix encryption in SMB3.1.1 (bsc#1144333).
  • cifs: Fix encryption/signing (bsc#1144333).
  • cifs: Fix error mapping for SMB2_LOCK command which caused OFD lock problem (bsc#1051510, bsc#1144333).
  • cifs: Fix error paths in writeback code (bsc#1144333).
  • cifs: fix GlobalMidLock bug in cifsreconnect (bsc#1144333).
  • cifs: fix handle leak in smb2querysymlink() (bsc#1144333).
  • cifs: fix incorrect handling of smb2setsparse() return in smb3simplefalloc (bsc#1144333).
  • cifs: Fix infinite loop when using hard mount option (bsc#1091171, bsc#1144333).
  • cifs: Fix invalid check in _cifscalc_signature() (bsc#1144333).
  • cifs: Fix kernel oops when traceSMB is enabled (bsc#1144333).
  • cifs: fix kref underflow in close_shroot() (bsc#1144333).
  • cifs: Fix leaking locked VFS cache pages in writeback retry (bsc#1144333).
  • cifs: Fix lease buffer length error (bsc#1144333).
  • cifs: fix memory leak and remove dead code (bsc#1144333).
  • cifs: fix memory leak in SMB2_open() (bsc#1112894, bsc#1144333).
  • cifs: fix memory leak in SMB2_read (bsc#1144333).
  • cifs: Fix memory leak in smb2setea() (bsc#1051510, bsc#1144333).
  • cifs: fix memory leak of an allocated cifs_ntsd structure (bsc#1144333).
  • cifs: fix memory leak of pneg_inbuf on -EOPNOTSUPP ioctl case (bsc#1144333).
  • cifs: Fix missing putxid in cifsfilestrictmmap (bsc#1087092, bsc#1144333).
  • cifs: Fix module dependency (bsc#1144333).
  • cifs: Fix mounts if the client is low on credits (bsc#1144333).
  • cifs: fix NULL deref in SMB2_read (bsc#1085539, bsc#1144333).
  • cifs: Fix NULL pointer dereference of devname (bnc#1129519).
  • cifs: Fix NULL pointer deref on SMB2_tcon() failure (bsc#1071009, bsc#1144333).
  • cifs: Fix NULL ptr deref (bsc#1144333).
  • cifs: fix page reference leak with readv/writev (bsc#1144333).
  • cifs: fix panic in smb2_reconnect (bsc#1144333).
  • cifs: fix parsing of symbolic link error response (bsc#1144333).
  • cifs: fix POSIX lock leak and invalid ptr deref (bsc#1114542, bsc#1144333).
  • cifs: Fix possible hang during async MTU reads and writes (bsc#1051510, bsc#1144333).
  • cifs: Fix possible oops and memory leaks in async IO (bsc#1144333).
  • cifs: Fix potential OOB access of lock element array (bsc#1051510, bsc#1144333).
  • cifs: Fix read after write for files with read caching (bsc#1051510, bsc#1144333).
  • cifs: fix return value for cifs_listxattr (bsc#1051510, bsc#1144333).
  • cifs: fix rmmod regression in cifs.ko caused by force_sig changes (bsc#1144333).
  • cifs: Fix separator when building path from dentry (bsc#1051510, bsc#1144333).
  • cifs: fix sha512 check in cifscryptosecmech_release (bsc#1051510, bsc#1144333).
  • cifs: Fix signing for SMB2/3 (bsc#1144333).
  • cifs: Fix slab-out-of-bounds in sendsetinfo() on SMB2 ACE setting (bsc#1144333).
  • cifs: Fix slab-out-of-bounds when tracing SMB tcon (bsc#1144333).
  • cifs: fix SMB1 breakage (bsc#1144333).
  • cifs: fix smb3zerorange for Azure (bsc#1144333).
  • cifs: fix smb3zerorange so it can expand the file-size when required (bsc#1144333).
  • cifs: fix spelling mistake, EACCESS -> EACCES (bsc#1144333).
  • cifs: Fix stack out-of-bounds in smb{2,3}createlease_buf() (bsc#1051510, bsc#1144333).
  • cifs: fix strcat buffer overflow and reduce raciness in smb21setoplock_level() (bsc#1144333).
  • cifs: Fix to use kmemcachefree() instead of kfree() (bsc#1144333).
  • cifs: Fix trace command logging for SMB2 reads and writes (bsc#1144333).
  • cifs: fix typo in cifs_dbg (bsc#1144333).
  • cifs: fix typo in debug message with struct field ia_valid (bsc#1144333).
  • cifs: fix uninitialized ptr deref in smb2 signing (bsc#1144333).
  • cifs: Fix use-after-free in SMB2_read (bsc#1144333).
  • cifs: Fix use-after-free in SMB2_write (bsc#1144333).
  • cifs: Fix use after free of a midqentry (bsc#1112903, bsc#1144333).
  • cifs: fix use-after-free of the lease keys (bsc#1144333).
  • cifs: Fix validation of signed data in smb2 (bsc#1144333).
  • cifs: Fix validation of signed data in smb3+ (bsc#1144333).
  • cifs: fix wrapping bugs in num_entries() (bsc#1051510, bsc#1144333).
  • cifs: flush before set-info if we have writeable handles (bsc#1144333).
  • cifs: For SMB2 security informaion query, check for minimum sized security descriptor instead of sizeof FileAllInformation class (bsc#1051510, bsc#1144333).
  • cifs: handle large EA requests more gracefully in smb2+ (bsc#1144333).
  • cifs: handle netapp error codes (bsc#1136261).
  • cifs: hide unused functions (bsc#1051510, bsc#1144333).
  • cifs: hide unused functions (bsc#1051510, bsc#1144333).
  • cifs: implement v3.11 preauth integrity (bsc#1051510, bsc#1144333).
  • cifs: In Kconfig CONFIGCIFSPOSIX needs depends on legacy (insecure cifs) (bsc#1144333).
  • cifs: integer overflow in in SMB2_ioctl() (bsc#1051510, bsc#1144333).
  • cifs: Introduce helper function to get page offset and length in smb_rqst (bsc#1144333).
  • cifs: Introduce offset for the 1st page in data transfer structures (bsc#1144333).
  • cifs: invalidate cache when we truncate a file (bsc#1051510, bsc#1144333).
  • cifs: keep FileInfo handle live during oplock break (bsc#1106284, bsc#1131565, bsc#1144333).
  • cifs: limit amount of data we request for xattrs to CIFSMaxBufSize (bsc#1144333).
  • cifs: Limit memory used by lock request calls to a page (bsc#1144333).
  • cifslookup(): cifsgetinode...() never returns 0 with *inode left NULL (bsc#1144333).
  • cifslookup(): switch to dsplice_alias() (bsc#1144333).
  • cifs: make arrays static const, reduces object code size (bsc#1144333).
  • cifs: Make devname param optional in cifscomposemount_options() (bsc#1144333).
  • cifs: make IPC a regular tcon (bsc#1071306, bsc#1144333).
  • cifs: make minor clarifications to module params for cifs.ko (bsc#1144333).
  • cifs: make mknod() an smbversionop (bsc#1144333).
  • cifs: make 'nodfs' mount opt a superblock flag (bsc#1051510, bsc#1144333).
  • cifs: make rmdir() use compounding (bsc#1144333).
  • cifs: make smbsendrqst take an array of requests (bsc#1144333).
  • cifs: Make sure all data pages are signed correctly (bsc#1144333).
  • cifs: Make use of DFS cache to get new DFS referrals (bsc#1144333).
  • cifs: Mask off signals when sending SMB packets (bsc#1144333).
  • cifs: minor clarification in comments (bsc#1144333).
  • cifs: Minor Kconfig clarification (bsc#1144333).
  • cifs: minor updates to module description for cifs.ko (bsc#1144333).
  • cifs: Move credit processing to mid callbacks for SMB3 (bsc#1144333).
  • cifs: move default port definitions to cifsglob.h (bsc#1144333).
  • cifs: move large array from stack to heap (bsc#1144333).
  • cifs: Move open file handling to writepages (bsc#1144333).
  • cifs: Move unlocking pages from wdatasendpages() (bsc#1144333).
  • cifs: OFD locks do not conflict with eachothers (bsc#1051510, bsc#1144333).
  • cifs: Only free DFS target list if we actually got one (bsc#1144333).
  • cifs: Only send SMB2_NEGOTIATE command on new TCP connections (bsc#1144333).
  • cifs: only wake the thread for the very last PDU in a compound (bsc#1144333).
  • cifs: parse and store info on iface queries (bsc#1144333).
  • cifs: pass flags down into waitforfree_credits() (bsc#1144333).
  • cifs: Pass page offset for calculating signature (bsc#1144333).
  • cifs: Pass page offset for encrypting (bsc#1144333).
  • cifs: pass page offsets on SMB1 read/write (bsc#1144333).
  • cifs: prevent integer overflow in nxtdirentry() (bsc#1051510, bsc#1144333).
  • cifs: prevent starvation in waitforfree_credits for multi-credit requests (bsc#1144333).
  • cifs: print CIFSMaxBufSize as part of /proc/fs/cifs/DebugData (bsc#1144333).
  • cifs: Print message when attempting a mount (bsc#1144333).
  • cifs: Properly handle auto disabling of serverino option (bsc#1144333).
  • cifs: protect against server returning invalid file system block size (bsc#1144333).
  • cifs: prototype declaration and definition for smb 2 - 3 and cifsacl mount options (bsc#1051510, bsc#1144333).
  • cifs: prototype declaration and definition to set acl for smb 2 - 3 and cifsacl mount options (bsc#1051510, bsc#1144333).
  • cifs: push rfc1002 generation down the stack (bsc#1144333).
  • cifs: read overflow in isvalidoplock_break() (bsc#1144333).
  • cifs: Reconnect expired SMB sessions (bnc#1060662).
  • cifs: refactor and clean up arguments in the reparse point parsing (bsc#1144333).
  • cifs: refactor crypto shash/sdesc allocation&free (bsc#1051510, bsc#1144333).
  • cifs: Refactor out cifs_mount() (bsc#1144333).
  • cifs: release auth_key.response for reconnect (bsc#1085536, bsc#1144333).
  • cifs: release cifs rootcred after exitcifs (bsc#1085536, bsc#1144333).
  • cifs: remove coverity warning in calclanmanhash (bsc#1144333).
  • cifs: Remove custom credit adjustments for SMB2 async IO (bsc#1144333).
  • cifs: remove headerpreamblesize where it is always 0 (bsc#1144333).
  • cifs: remove redundant duplicated assignment of pointer 'node' (bsc#1144333).
  • cifs: remove rfc1002 hardcoded constants from cifsdiscardremaining_data() (bsc#1144333).
  • cifs: remove rfc1002 header from all SMB2 response structures (bsc#1144333).
  • cifs: remove rfc1002 header from smb2closereq (bsc#1144333).
  • cifs: remove rfc1002 header from smb2createreq (bsc#1144333).
  • cifs: remove rfc1002 header from smb2echoreq (bsc#1144333).
  • cifs: remove rfc1002 header from smb2flushreq (bsc#1144333).
  • cifs: remove rfc1002 header from smb2ioctlreq (bsc#1144333).
  • cifs: remove rfc1002 header from smb2leaseack (bsc#1144333).
  • cifs: remove rfc1002 header from smb2lockreq (bsc#1144333).
  • cifs: remove rfc1002 header from smb2logoffreq (bsc#1144333).
  • cifs: remove rfc1002 header from smb2negotiatereq (bsc#1144333).
  • cifs: remove rfc1002 header from smb2oplockbreak we get from server (bsc#1144333).
  • cifs: remove rfc1002 header from smb2querydirectory_req (bsc#1144333).
  • cifs: remove rfc1002 header from smb2queryinfo_req (bsc#1144333).
  • cifs: remove rfc1002 header from smb2 read/write requests (bsc#1144333).
  • cifs: remove rfc1002 header from smb2sesssetup_req (bsc#1144333).
  • cifs: remove rfc1002 header from smb2setinfo_req (bsc#1144333).
  • cifs: remove rfc1002 header from smb2treeconnect_req (bsc#1144333).
  • cifs: remove rfc1002 header from smb2treedisconnect_req (bsc#1144333).
  • cifs: remove set but not used variable 'cifs_sb' (bsc#1144333).
  • cifs: remove set but not used variable 'sep' (bsc#1144333).
  • cifs: remove set but not used variable 'server' (bsc#1144333).
  • cifs: remove set but not used variable 'smb_buf' (bsc#1144333).
  • cifs: remove smallsmb2init (bsc#1144333).
  • cifs: remove smb2sendrecv() (bsc#1144333).
  • cifs: remove struct smb2_hdr (bsc#1144333).
  • cifs: remove struct smb2oplockbreak_rsp (bsc#1144333).
  • cifs: remove the isfalloc argument to SMB2set_eof (bsc#1144333).
  • cifs: remove unused stats (bsc#1144333).
  • cifs: remove unused value pointed out by Coverity (bsc#1144333).
  • cifs: remove unused variable from SMB2_read (bsc#1144333).
  • cifs: rename and clarify CIFSASYNCOP and CIFSNORESP (bsc#1144333).
  • cifs: Reopen file before get SMB2 MTU credits for async IO (bsc#1144333).
  • cifs: replace a 4 with server->vals->headerpreamblesize (bsc#1144333).
  • cifs: replace snprintf with scnprintf (bsc#1144333).
  • cifs: Respect reconnect in MTU credits calculations (bsc#1144333).
  • cifs: Respect reconnect in non-MTU credits calculations (bsc#1144333).
  • cifs: Respect SMB2 hdr preamble size in read responses (bsc#1144333).
  • cifs: return correct errors when pinning memory failed for direct I/O (bsc#1144333).
  • cifs: Return -EAGAIN instead of -ENOTSOCK (bsc#1144333).
  • cifs: return -ENODATA when deleting an xattr that does not exist (bsc#1144333).
  • cifs: Return error code when getting file handle for writeback (bsc#1144333).
  • cifs: return error on invalid value written to cifsFYI (bsc#1144333).
  • cifs: Save TTL value when parsing DFS referrals (bsc#1144333).
  • cifs: Select all required crypto modules (bsc#1085536, bsc#1144333).
  • cifs: set mapping error when page writeback fails in writepage or launder_pages (bsc#1144333).
  • cifs: set oparms.createoptions rather than or'ing in CREATEOPENBACKUPINTENT (bsc#1144333).
  • cifs: Set reconnect instance to one initially (bsc#1144333).
  • cifs: set *respbuftype to NO_BUFFER on error (bsc#1144333).
  • cifs: Show locallease in /proc/mounts for cifs shares mounted with locallease feature (bsc#1144333).
  • cifs: show 'soft' in the mount options for hard mounts (bsc#1144333).
  • cifs: show the w bit for writeable /proc/fs/cifs/ files (bsc#1144333).
  • cifs: silence compiler warnings showing up with gcc-8.0.0 (bsc#1090734, bsc#1144333).
  • cifs: Silence uninitialized variable warning (bsc#1144333).
  • cifs: simple stats should always be enabled (bsc#1144333).
  • cifs: simplify code by removing CONFIGCIFSACL ifdef (bsc#1144333). - Update config files.
  • cifs: simplify how we handle credits in compoundsendrecv() (bsc#1144333).
  • cifs: Skip any trailing backslashes from UNC (bsc#1144333).
  • cifs: smb2 commands can not be negative, remove confusing check (bsc#1144333).
  • cifs: smb2ops: Fix listxattr() when there are no EAs (bsc#1051510, bsc#1144333).
  • cifs: smb2ops: Fix NULL check in smb2querysymlink (bsc#1144333).
  • cifs: smb2pdu: Fix potential NULL pointer dereference (bsc#1144333).
  • cifs: SMBD: Add parameter rdata to smb2newreadreq (bsc#1144333).
  • cifs: SMBD: Add rdma mount option (bsc#1144333).
  • cifs: SMBD: Add SMB Direct debug counters (bsc#1144333).
  • cifs: SMBD: Add SMB Direct protocol initial values and constants (bsc#1144333).
  • cifs: smbd: Avoid allocating iov on the stack (bsc#1144333).
  • cifs: smbd: avoid reconnect lockup (bsc#1144333).
  • cifs: smbd: Check for iov length on sending the last iov (bsc#1144333).
  • cifs: smbd: depend on INFINIBANDADDRTRANS (bsc#1144333).
  • cifs: SMBD: Disable signing on SMB direct transport (bsc#1144333).
  • cifs: smbd: disconnect transport on RDMA errors (bsc#1144333).
  • cifs: SMBD: Do not call ibderegmr on invalidated memory registration (bsc#1144333).
  • cifs: smbd: Do not destroy transport on RDMA disconnect (bsc#1144333).
  • cifs: smbd: Do not use RDMA read/write when signing is used (bsc#1144333).
  • cifs: smbd: Dump SMB packet when configured (bsc#1144333).
  • cifs: smbd: Enable signing with smbdirect (bsc#1144333).
  • cifs: SMBD: Establish SMB Direct connection (bsc#1144333).
  • cifs: SMBD: export protocol initial values (bsc#1144333).
  • cifs: SMBD: fix spelling mistake: faield and legnth (bsc#1144333).
  • cifs: SMBD: Fix the definition for SMB2CHANNELRDMAV1INVALIDATE (bsc#1144333).
  • cifs: SMBD: Implement function to create a SMB Direct connection (bsc#1144333).
  • cifs: SMBD: Implement function to destroy a SMB Direct connection (bsc#1144333).
  • cifs: SMBD: Implement function to receive data via RDMA receive (bsc#1144333).
  • cifs: SMBD: Implement function to reconnect to a SMB Direct transport (bsc#1144333).
  • cifs: SMBD: Implement function to send data via RDMA send (bsc#1144333).
  • cifs: SMBD: Implement RDMA memory registration (bsc#1144333).
  • cifs: smbd: Indicate to retry on transport sending failure (bsc#1144333).
  • cifs: SMBD: Read correct returned data length for RDMA write (SMB read) I/O (bsc#1144333).
  • cifs: smbd: Retry on memory registration failure (bsc#1144333).
  • cifs: smbd: Return EINTR when interrupted (bsc#1144333).
  • cifs: SMBD: Set SMB Direct maximum read or write size for I/O (bsc#1144333).
  • cifs: SMBD: smbdgetconnection() can be static (bsc#1144333).
  • cifs: SMBD: Support page offset in memory registration (bsc#1144333).
  • cifs: SMBD: Support page offset in RDMA recv (bsc#1144333).
  • cifs: SMBD: Support page offset in RDMA send (bsc#1144333).
  • cifs: smbd: take an array of reqeusts when sending upper layer data (bsc#1144333).
  • cifs: SMBD: Upper layer connects to SMBDirect session (bsc#1144333).
  • cifs: SMBD: Upper layer destroys SMB Direct session on shutdown or umount (bsc#1144333).
  • cifs: SMBD: Upper layer performs SMB read via RDMA write through memory registration (bsc#1144333).
  • cifs: SMBD: Upper layer performs SMB write via RDMA read through memory registration (bsc#1144333).
  • cifs: SMBD: Upper layer receives data via RDMA receive (bsc#1144333).
  • cifs: SMBD: Upper layer reconnects to SMB Direct session (bsc#1144333).
  • cifs: SMBD: Upper layer sends data via RDMA send (bsc#1144333).
  • cifs:smbd Use the correct DMA direction when sending data (bsc#1144333).
  • cifs:smbd When reconnecting to server, call smbddestroy() after all MIDs have been called (bsc#1144333).
  • cifs: SMBD: work around gcc -Wmaybe-uninitialized warning (bsc#1144333).
  • cifs: start DFS cache refresher in cifsmount() (bsc#1144333).
  • cifs: store the leaseKey in the fid on SMB2open (bsc#1051510, bsc#1144333).
  • cifs: suppress some implicit-fallthrough warnings (bsc#1144333).
  • cifs: track writepages in vfs operation counters (bsc#1144333).
  • cifs: Try to acquire credits at once for compound requests (bsc#1144333).
  • cifs: update calcsize to take a server argument (bsc#1144333).
  • cifs: update initsg, cryptmessage to take an array of rqst (bsc#1144333).
  • cifs: update internal module number (bsc#1144333).
  • cifs: update internal module version number (bsc#1144333).
  • cifs: update internal module version number (bsc#1144333).
  • cifs: update internal module version number (bsc#1144333).
  • cifs: update internal module version number (bsc#1144333).
  • cifs: update internal module version number (bsc#1144333).
  • cifs: update internal module version number for cifs.ko to 2.12 (bsc#1144333).
  • cifs: update internal module version number for cifs.ko to 2.12 (bsc#1144333).
  • cifs: update internal module version number for cifs.ko to 2.14 (bsc#1144333).
  • cifs: update module internal version number (bsc#1144333).
  • cifs: update multiplex loop to handle compounded responses (bsc#1144333).
  • cifs: update receiveencryptedstandard to handle compounded responses (bsc#1144333).
  • cifs: update smb2calcsize to use smb2synchdr instead of smb2hdr (bsc#1144333).
  • cifs: update smb2checkmessage to handle PDUs without a 4 byte length header (bsc#1144333).
  • cifs: update smb2queryfs() to use compounding (bsc#1144333).
  • cifs: update smbsendrqst() to take an array of requests (bsc#1144333).
  • cifs: use a compound for setting an xattr (bsc#1144333).
  • cifs: use a refcount to protect open/closing the cached file handle (bsc#1144333).
  • cifs: use correct format characters (bsc#1144333).
  • cifs: Use correct packet length in SMB2TRANSFORM header (bsc#1144333).
  • cifs: Use GFPATOMIC when a lock is held in cifsmount() (bsc#1144333).
  • cifs: Use kmemdup in SMB2ioctlinit() (bsc#1144333).
  • cifs: Use kmemdup rather than duplicating its implementation in smb311posixmkdir() (bsc#1144333).
  • cifs: Use kzfree() to free password (bsc#1144333).
  • cifs: Use offset when reading pages (bsc#1144333).
  • cifs: Use smb 2 - 3 and cifsacl mount options getacl functions (bsc#1051510, bsc#1144333).
  • cifs: Use smb 2 - 3 and cifsacl mount options setacl function (bsc#1051510, bsc#1144333).
  • cifs: use tconipc instead of useipc parameter of SMB2ioctl (bsc#1071306, bsc#1144333).
  • cifs: use the correct length when pinning memory for direct I/O for write (bsc#1144333).
  • cifs: Use ULL suffix for 64-bit constant (bsc#1051510, bsc#1144333).
  • cifs: waitforfreecredits() make it possible to wait for >=1 credits (bsc#1144333).
  • cifs: we can not use small padding iovs together with encryption (bsc#1144333).
  • cifs: When sending data on socket, pass the correct page offset (bsc#1144333).
  • cifs: zero-range does not require the file is sparse (bsc#1144333).
  • cifs: zero sensitive data when freeing (bsc#1087092, bsc#1144333).
  • Cleanup some minor endian issues in smb3 rdma (bsc#1144333).
  • clk: add clkbulkget accessories (bsc#1144813).
  • clk: at91: fix update bit maps on CFGMOR write (bsc#1051510).
  • clk: bcm2835: remove pllb (jsc#SLE-7294).
  • clk: bcm283x: add driver interfacing with Raspberry Pi's firmware (jsc#SLE-7294).
  • clk: bulk: silently error out on EPROBEDEFER (bsc#1144718,bsc#1144813).
  • clk: Export clkbulkprepare() (bsc#1144813).
  • clk: qcom: Fix -Wunused-const-variable (bsc#1051510).
  • clk: raspberrypi: register platform device for raspberrypi-cpufreq (jsc#SLE-7294).
  • clk: renesas: cpg-mssr: Fix reset control race condition (bsc#1051510).
  • clk: rockchip: Add 1.6GHz PLL rate for rk3399 (bsc#1144718,bsc#1144813).
  • clk: rockchip: assign correct id for pclkddr and hclksd in rk3399 (bsc#1144718,bsc#1144813).
  • clk: rockchip: Do not yell about bad mmc phases when getting (bsc#1051510).
  • clk: rockchip: Turn on 'aclkdmac1' for suspend on rk3288 (bsc#1051510).
  • clk: sunxi-ng: v3s: add missing clock slices for MMC2 module clocks (bsc#1051510).
  • clk: sunxi-ng: v3s: add the missing PLLDDR1 (bsc#1051510).
  • clk: tegra210: fix PLLU and PLLUOUT1 (bsc#1051510).
  • clk: tegra: Fix PLLM programming on Tegra124+ when PMC overrides divider (bsc#1051510).
  • compatioctl: pppoe: fix PPPOEIOCSFWD handling (bsc#1051510).
  • coredump: split pipe command whitespace before expanding template (bsc#1051510).
  • coresight: etb10: Fix handling of perf mode (bsc#1051510).
  • coresight: etm4x: Add support to enable ETMv4.2 (bsc#1051510).
  • cpufreq: acpi-cpufreq: Report if CPU does not support boost technologies (bsc#1051510).
  • cpufreq: add driver for Raspberry Pi (jsc#SLE-7294).
  • cpufreq: Add Hygon Dhyana support ().
  • cpufreq: AMD: Ignore the check for ProcFeedback in ST/CZ ().
  • cpufreq: brcmstb-avs-cpufreq: Fix initial command check (bsc#1051510).
  • cpufreq: brcmstb-avs-cpufreq: Fix types for voltage/frequency (bsc#1051510).
  • cpufreq: check if policy is inactive early in cpufreqget() (bsc#1051510).
  • cpufreq: dt: Try freeing static OPPs only if we have added them (jsc#SLE-7294).
  • cpufreq: kirkwood: fix possible object reference leak (bsc#1051510).
  • cpufreq/pasemi: fix possible object reference leak (bsc#1051510).
  • cpufreq: pmac32: fix possible object reference leak (bsc#1051510).
  • cpufreq: ppccbe: fix possible object reference leak (bsc#1051510).
  • cpufreq: Use struct kobjattribute instead of struct globalattr (bsc#1051510).
  • cpu/speculation: Warn on unsupported mitigations= parameter (bsc#1114279).
  • cpu/topology: Export dieid (jsc#SLE-5454).
  • crypto: algapi - guard against uninitialized spawn list in cryptoremovespawns (bsc#1133401).
  • crypto: arm64/sha1-ce - correct digest for empty data in finup (bsc#1051510).
  • crypto: arm64/sha2-ce - correct digest for empty data in finup (bsc#1051510).
  • crypto: caam - fix concurrency issue in givencrypt descriptor (bsc#1051510).
  • crypto: caam - free resources in case caamrng registration failed (bsc#1051510).
  • crypto: cavium/zip - Add missing singlerelease() (bsc#1051510).
  • crypto: ccp - Add support for valid authsize values less than 16 (bsc#1051510).
  • crypto: ccp - Fix 3DES complaint from ccp-crypto module (bsc#1051510).
  • crypto: ccp - fix AES CFB error exposed by new test vectors (bsc#1051510).
  • crypto: ccp - Fix oops by properly managing allocated structures (bsc#1051510).
  • crypto: ccp - Fix SEVVERSIONGREATEROREQUAL (bsc#1051510).
  • crypto: ccp - fix the SEV probe in kexec boot path (bsc#1136896).
  • crypto: ccp/gcm - use const time tag comparison (bsc#1051510).
  • crypto: ccp - Ignore tag length when decrypting GCM ciphertext (bsc#1051510).
  • crypto: ccp - Ignore unconfigured CCP device on suspend/resume (bnc#1145934).
  • crypto: ccp - memset structure fields to zero before reuse (bsc#1051510).
  • crypto: ccp - Reduce maximum stack usage (bsc#1051510).
  • crypto: ccp - Validate buffer lengths for copy operations (bsc#1051510).
  • crypto: ccp - Validate the the error value used to index error messages (bsc#1051510).
  • crypto: chacha20poly1305 - fix atomic sleep when using async algorithm (bsc#1051510).
  • crypto: cryptd - Fix skcipher instance memory leak (bsc#1051510).
  • crypto: crypto4xx - fix a potential double free in ppc4xxtrngprobe (bsc#1051510).
  • crypto: ghash - fix unaligned memory access in ghashsetkey() (bsc#1051510).
  • crypto: qat - Silence smpprocessorid() warning (bsc#1051510).
  • crypto: skcipher - Unmap pages after an external error (bsc#1051510).
  • crypto: talitos - Align SEC1 accesses to 32 bits boundaries (bsc#1051510).
  • crypto: talitos - check data blocksize in ablkcipher (bsc#1051510).
  • crypto: talitos - fix CTR alg blocksize (bsc#1051510).
  • crypto: talitos - fix max key size for sha384 and sha512 (bsc#1051510).
  • crypto: talitos - fix skcipher failure due to wrong output IV (bsc#1051510).
  • crypto: talitos - HMAC SNOOP NO AFEU mode requires SW icv checking (bsc#1051510).
  • crypto: talitos - properly handle split ICV (bsc#1051510).
  • crypto: talitos - reduce max key size for SEC1 (bsc#1051510).
  • crypto: talitos - rename alternative AEAD algos (bsc#1051510).
  • crypto: user - prevent operating on larval algorithms (bsc#1133401).
  • crypto: vmx - ghash: do nosimd fallback manually (bsc#1135661, bsc#1137162).
  • crypto: vmx - return correct error code on failed setkey (bsc#1135661, bsc#1137162).
  • cx82310eth: fix a memory leak bug (bsc#1051510).
  • dasdfba: Display '00000000' for zero page when dumping sense (bsc#1123080).
  • dax: daxlayoutbusypage() should not unmap cow pages (bsc#1148698).
  • dax: Fix xarray entry association for mixed mappings (bsc#1140893).
  • Delete for bsc#1144979: bcache: kernel oops on reading sysfs cachemode file patches.suse/0031-bcache-use-sysfsmatchstring-instead-of-sysfsmat.patch.
  • device core: Consolidate locking and unlocking of parent and device (bsc#1106383).
  • devres: always use devname() in devmioremapresource() (git fixes).
  • dfscache: fix a wrong use of kfree in flushcacheent() (bsc#1144333).
  • dma-buf: balance refcount inbalance (bsc#1051510).
  • dmaengine: dw: platform: Switch to acpidmacontrollerregister() (bsc#1051510).
  • dmaengine: hsu: Revert 'set HSUCHMTSR to memory width' (bsc#1051510).
  • dmaengine: imx-sdma: remove BDINTR for channel0 (bsc#1051510).
  • dmaengine: iop-adma.c: fix printk format warning (bsc#1051510).
  • dmaengine: rcar-dmac: Reject zero-length slave DMA requests (bsc#1051510).
  • dm btree: fix order of block initialization in btreesplitbeneath (git fixes).
  • dm bufio: fix deadlock with loop device (git fixes).
  • dm cache metadata: Fix loading discard bitset (git fixes).
  • dm crypt: do not overallocate the integrity tag space (git fixes).
  • dm crypt: fix parsing of extended IV arguments (git fixes).
  • dm, dax: Fix detection of DAX support (bsc#1139782).
  • dm delay: fix a crash when invalid device is specified (git fixes).
  • dm: fix tosector() for 32bit (git fixes).
  • dm integrity: change memcmp to strncmp in dmintegrityctr (git fixes).
  • dm integrity: limit the rate of error messages (git fixes).
  • dm kcopyd: always complete failed jobs (git fixes).
  • dm log writes: make sure super sector log updates are written in order (git fixes).
  • dm raid: add missing cleanup in raidctr() (git fixes).
  • dm: revert 8f50e358153d ('dm: limit the max bio size as BIOMAXPAGES * PAGESIZE') (git fixes).
  • dm space map metadata: fix missing store of applybops() return value (git fixes).
  • dm table: fix invalid memory accesses with too high sector number (git fixes).
  • dm table: propagate BDICAPSTABLEWRITES to fix sporadic checksum errors (git fixes).
  • dm thin: fix bug where bio that overwrites thin block ignores FUA (git fixes).
  • dm thin: fix passdowndoublecheckingsharedstatus() (git fixes).
  • dm zoned: fix potential NULL dereference in dmzdoreclaim() (git fixes).
  • dm zoned: Fix zone report handling (git fixes).
  • dm zoned: fix zone state management race (git fixes).
  • dm zoned: improve error handling in i/o map code (git fixes).
  • dm zoned: improve error handling in reclaim (git fixes).
  • dm zoned: properly handle backing device failure (git fixes).
  • dm zoned: Silence a static checker warning (git fixes).
  • doc: Cope with the deprecation of AutoReporter (bsc#1051510).
  • docs: Fix conf.py for Sphinx 2.0 (bsc#1135642).
  • Documentation: Add MDS vulnerability documentation (bsc#1135642).
  • Documentation: Add nospectrev1 parameter (bsc#1051510).
  • Documentation: Correct the possible MDS sysfs values (bsc#1135642).
  • Documentation: DMA-API: fix a function name of maxmappingsize (bsc#1140954).
  • Documentation/networking: fix defaultttl typo in mpls-sysctl (bsc#1051510).
  • Do not log confusing message on reconnect by default (bsc#1129664, bsc#1144333).
  • Do not log expected error on DFS referral request (bsc#1051510, bsc#1144333).
  • Do not provide kernel-default from kernel-default-base (boo#1132154, bsc#1106751).
  • Do not provide kernel-default-srchash from kernel-default-base.
  • Do not restrict NFSv4.2 on openSUSE (bsc#1138719).
  • dpaaeth: fix SG frame cleanup (networking-stable-190514).
  • drbd: Avoid Clang warning about pointless switch statment (bsc#1051510).
  • drbd: disconnect, if the wrong UUIDs are attached on a connected peer (bsc#1051510).
  • drbd: narrow rcureadlock in drbdsynchandshake (bsc#1051510).
  • drbd: skip spurious timeout (ping-timeo) when failing promote (bsc#1051510).
  • driver core: Establish order of operations for deviceadd and devicedel via bitflag (bsc#1106383).
  • driver core: Fix use-after-free and double free on glue directory (bsc#1131281).
  • driver core: Probe devices asynchronously instead of the driver (bsc#1106383).
  • drivers: acpi: add dependency of EFI for arm64 (bsc#1117158).
  • drivers/base: Introduce killdevice() (bsc#1139865).
  • drivers/base: kABI fixes for struct deviceprivate (bsc#1106383).
  • drivers: misc: fix out-of-bounds access in function paramsetkgdbtsvar (bsc#1051510).
  • drivers/pps/pps.c: clear offset flags in PPSSETPARAMS ioctl (bsc#1051510).
  • drivers/rapidio/devices/riomportcdev.c: fix resource leak in error handling path in 'riodmatransfer()' (bsc#1051510).
  • drivers/rapidio/devices/riomportcdev.c: NUL terminate some strings (bsc#1051510).
  • drivers/rapidio/riocm.c: fix potential oops in riocmchlisten() (bsc#1051510).
  • drivers: thermal: int340xthermal: Fix sysfs race condition (bsc#1051510).
  • drivers: thermal: tsens: Do not print error message on -EPROBEDEFER (bsc#1051510).
  • drm/amdgpu: fix old fence check in amdgpufenceemit (bsc#1051510).
  • drm/amdgpu/gfx9: use reset default for PASCFIFOSIZE (bsc#1051510).
  • drm/amdgpu/psp: move psp version specific function pointers to (bsc#1135642)
  • drm/arm/hdlcd: Allow a bit of clock tolerance (bsc#1051510).
  • drm/bridge: sii902x: pixel clock unit is 10kHz instead of 1kHz (bsc#1051510).
  • drm/bridge: tc358767: read displayprops in getmodes() (bsc#1051510).
  • drm/crc-debugfs: User irqsafe spinlock in drmcrtcaddcrcentry (bsc#1051510).
  • drm/drv: Hold ref on parent device during drmdevice lifetime (bsc#1051510).
  • drm/etnaviv: add missing failure path to destroy suballoc (bsc#1135642)
  • drm/gma500/cdv: Check vbt config bits when detecting lvds panels (bsc#1051510).
  • drm/i915/dmc: protect against reading random memory (bsc#1051510).
  • drm/i915: Do not deballoon unused ggtt drmmmnode in linux guest (bsc#1142635)
  • drm/i915: Fix various tracepoints for gen2 (bsc#1113722)
  • drm/i915: Fix wrong escape clock divisor init for GLK (bsc#1142635)
  • drm/i915/gvt: Fix cmd length of VEBDIIECP (bsc#1113722)
  • drm/i915/gvt: ignore unexpected pvinfo write (bsc#1051510).
  • drm/i915/gvt: refine ggtt range validation (bsc#1113722)
  • drm/i915/perf: ensure we keep a reference on the driver (bsc#1142635)
  • drm/i915/perf: fix whitelist on Gen10+ (bsc#1051510).
  • drm/i915: Restore relaxed padding (OCLOOBSUPPRESENABLE) for skl+ (bsc#1142635)
  • drm/i915/sdvo: Implement proper HDMI audio support for SDVO (bsc#1051510).
  • drm/i915/userptr: Acquire the page lock around setpagedirty() (bsc#1051510).
  • drm/imx: Drop unused imx-ipuv3-crtc.o build (bsc#1113722)
  • drm/imx: notify drm core before sending event during crtc disable (bsc#1135642)
  • drm/imx: only send event on crtc disable if kept disabled (bsc#1135642)
  • drm/mediatek: call drmatomichelpershutdown() when unbinding driver (bsc#1135642)
  • drm/mediatek: call mtkdsistop() after mtkdrmcrtcatomicdisable() (bsc#1135642)
  • drm/mediatek: clear numpipes when unbind driver (bsc#1135642)
  • drm/mediatek: fix unbind functions (bsc#1135642)
  • drm/mediatek: mtkdrmdrv.c: Add ofnodeput() before goto (bsc#1142635)
  • drm/mediatek: unbind components in mtkdrmunbind() (bsc#1135642)
  • drm/mediatek: use correct device to import PRIME buffers (bsc#1142635)
  • drm/meson: Add support for XBGR8888 & ABGR8888 formats (bsc#1051510).
  • drm/msm/a3xx: remove TPL1 regs from snapshot (bsc#1051510).
  • drm/msm: Depopulate platform on probe failure (bsc#1051510).
  • drm: msm: Fix addgpucomponents (bsc#1051510).
  • drm/msm/mdp5: Fix mdp5cfginit error return (bsc#1142635)
  • drm/nouveau/disp/dp: respect sink limits when selecting failsafe link configuration (bsc#1051510).
  • drm/nouveau: Do not retry infinitely when receiving no data on i2c (bsc#1142635)
  • drm/nouveau: fix memory leak in nouveauconnreset() (bsc#1051510).
  • drm/nouveau/i2c: Disable i2c bus access after ->fini() (bsc#1113722)
  • drm/nouveau/i2c: Enable i2c pads & busses during preinit (bsc#1051510).
  • drm/panel: simple: Fix panelsimpledsiprobe (bsc#1051510).
  • drm/radeon: prefer lower reference dividers (bsc#1051510).
  • drm/rockchip: Properly adjust to a true clock in adjustedmode (bsc#1051510).
  • drm/rockchip: Suspend DP late (bsc#1142635)
  • drm: silence variable 'conn' set but not used (bsc#1051510).
  • drm/udl: introduce a macro to convert dev to udl. (bsc#1113722)
  • drm/udl: move to embedding drm device inside udl device. (bsc#1113722)
  • drm/virtio: Add memory barriers for capset cache (bsc#1051510).
  • drm/vmwgfx: fix a warning due to missing dmaparms (bsc#1135642)
  • drm/vmwgfx: fix memory leak when too many retries have occurred (bsc#1051510).
  • drm/vmwgfx: Use the backdoor port if the HB port is not available (bsc#1135642)
  • drm: Wake up next in drmread() chain if we are forced to putback the event (bsc#1051510).
  • Drop an ASoC fix that was reverted in 4.14.y stable
  • e1000e: start network tx queue only when link is up (bsc#1051510).
  • eCryptfs: fix a couple type promotion bugs (bsc#1051510).
  • EDAC/amd64: Add Family 17h Model 30h PCI IDs (bsc#1112178).
  • EDAC, amd64: Add Family 17h, models 10h-2fh support (bsc#1112178).
  • EDAC, amd64: Add Hygon Dhyana support ().
  • EDAC/amd64: Decode syndrome before translating address (bsc#1114279).
  • EDAC: Fix global-out-of-bounds write when setting edacmcpollmsec (bsc#1114279).
  • EDAC/mc: Fix edacmcfind() in case no device is found (bsc#1114279).
  • eeprom: at24: make spd world-readable again (git-fixes).
  • efi: add API to reserve memory persistently across kexec reboot (bsc#1117158).
  • efi/arm: Defer persistent reservations until after paginginit() (bsc#1117158).
  • efi/arm: Do not mark ACPI reclaim memory as MEMBLOCKNOMAP (bsc#1117158 bsc#1115688 bsc#1120566).
  • efi/arm: libstub: add a root memreserve config table (bsc#1117158).
  • efi/arm: map UEFI memory map even w/o runtime services enabled (bsc#1117158).
  • efi/arm: preserve early mapping of UEFI memory map longer for BGRT (bsc#1117158).
  • efi/arm: Revert 'Defer persistent reservations until after paginginit()' (bsc#1117158).
  • efi/arm: Revert deferred unmap of early memmap mapping (bsc#1117158).
  • efi/bgrt: Drop BGRT status field reserved bits check (bsc#1051510).
  • efi: honour memory reservations passed via a linux specific config table (bsc#1117158).
  • efi: Permit calling efimemreservepersistent() from atomic context (bsc#1117158).
  • efi: Permit multiple entries in persistent memreserve data structure (bsc#1117158).
  • efi: Prevent GICv3 WARN() by mapping the memreserve table before first use (bsc#1117158).
  • efi: Reduce the amount of memblock reservations for persistent allocations (bsc#1117158).
  • ehea: Fix a copy-paste err in eheainitportres (bsc#1051510).
  • ethtool: check the return value of getregslen (git-fixes).
  • ethtool: fix potential userspace buffer overflow (networking-stable-190609).
  • ext4: do not delete unlinked inode from orphan list on failed truncate (bsc#1140891).
  • ext4: fix warning inside ext4convertunwrittenextentsendio (bsc#1152025).
  • ext4: set error return correctly when ext4htreestoredirent fails (bsc#1152024).
  • ext4: use jbd2inode dirty range scoping (bsc#1148616).
  • extcon: arizona: Disable mic detect if running when driver is removed (bsc#1051510).
  • firmware: efi: factor out memreserve (bsc#1117158 bsc#1134671).
  • firmware: raspberrypi: register clk device (jsc#SLE-7294).
  • firmware: tisci: Always request response from firmware (bsc#1051510).
  • Fixed https://bugzilla.kernel.org/showbug.cgi?id=202935 allow write on the same file (bsc#1144333).
  • Fix encryption labels and lengths for SMB3.1.1 (bsc#1085536, bsc#1144333).
  • fix incorrect error code mapping for OBJECTIDNOTFOUND (bsc#1144333).
  • Fix kABI after KVM fixes
  • Fix kABI for asus-wmi quirkentry field addition (bsc#1051510).
  • Fix kabi for: NFSv4: Fix OPEN / CLOSE race (git-fixes).
  • Fix matchserver check to allow for auto dialect negotiate (bsc#1144333).
  • Fix memory leak in sctpprocessinit (networking-stable-190609).
  • Fix SMB3.1.1 guest authentication to Samba (bsc#1085536, bsc#1144333).
  • fix smb3-encryption breakage when CONFIGDEBUGSG=y (bsc#1051510, bsc#1144333).
  • fix struct ufsreq removal of unused field (git-fixes).
  • Fix warning messages when mounting to older servers (bsc#1144333).
  • fork, memcg: fix cachedstacks case (bsc#1134097).
  • fork, memcg: fix crash in freethreadstack on memcg charge fail (bsc#1134097).
  • fs/cifs/cifsacl.c Fixes typo in a comment (bsc#1144333).
  • fs: cifs: cifsssmb: Change return type of convertacetocifsace (bsc#1144333).
  • fs/cifs: do not translate SFMSLASH (U+F026) to backslash (bsc#1144333).
  • fs: cifs: Drop unlikely before ISERR(ORNULL) (bsc#1144333).
  • fs/cifs: fix uninitialised variable warnings (bsc#1144333).
  • fs: cifs: Kconfig: pedantic formatting (bsc#1144333).
  • fs: cifs: Replace freexid call in cifsrootiget function (bsc#1144333).
  • fs/cifs: require sha512 (bsc#1051510, bsc#1144333).
  • fs/cifs: Simplify ibpost(send|recv|srqrecv)() calls (bsc#1144333).
  • fs/cifs/smb2pdu.c: fix buffer free in SMB2ioctlfree (bsc#1144333).
  • fs/cifs: suppress a string overflow warning (bsc#1144333).
  • fs//Kconfig: drop links to 404-compliant http://acl.bestbits.at (bsc#1144333).
  • fsl/fman: Use GFPATOMIC in {memac,tgec}addhashmac_address() (bsc#1051510).
  • fs/ocfs2: fix race in ocfs2dentryattach_lock() (bsc#1140889).
  • fs/proc/proc_sysctl.c: Fix a NULL pointer dereference (bsc#1140887).
  • fs/proc/procsysctl.c: fix NULL pointer dereference in putlinks (bsc#1140887).
  • fs/xfs: Fix return code of xfsbreakleased_layouts() (bsc#1148031).
  • fs: xfs: xfslog: Do not use KMMAYFAIL at xfslogreserve() (bsc#1148033).
  • ftrace: Check for empty hash and comment the race with registering probes (bsc#1149418).
  • ftrace: Check for successful allocation of hash (bsc#1149424).
  • ftrace: Fix NULL pointer dereference in tprobenext() (bsc#1149413).
  • ftrace/x86: Remove possible deadlock between registerkprobe() and ftracerunupdatecode() (bsc#1071995).
  • fuse: fallocate: fix return with locked inode (bsc#1051510).
  • fuse: fix writepages on 32bit (bsc#1051510).
  • fuse: honor RLIMITFSIZE in fusefile_fallocate (bsc#1051510).
  • genirq: Prevent use-after-free and work list corruption (bsc#1051510).
  • genirq: Respect IRQCHIPSKIPSETWAKE in irqchipsetwake_parent() (bsc#1051510).
  • genwqe: Prevent an integer overflow in the ioctl (bsc#1051510).
  • gpio: Fix build error of function redefinition (bsc#1051510).
  • gpio: fix gpio-adp5588 build errors (bsc#1051510).
  • gpio: fix line flag validation in lineevent_create (bsc#1051510).
  • gpio: fix line flag validation in linehandle_create (bsc#1051510).
  • gpio: gpio-omap: add check for off wake capable gpios (bsc#1051510).
  • gpiolib: fix incorrect IRQ requesting of an active-low lineevent (bsc#1051510).
  • gpiolib: never report open-drain/source lines as 'input' to user-space (bsc#1051510).
  • gpiolib: only check line handle flags once (bsc#1051510).
  • gpio: Move gpiochiplock/unlockas_irq to gpio/driver.h (bsc#1051510).
  • gpio: mxs: Get rid of external API call (bsc#1051510).
  • gpio: omap: ensure irq is enabled before wakeup (bsc#1051510).
  • gpio: omap: fix lack of irqstatus_raw0 for OMAP4 (bsc#1051510).
  • gpio: pxa: handle corner case of unprobed device (bsc#1051510).
  • gpio: Remove obsolete comment about gpiochipfreehogs() usage (bsc#1051510).
  • gpu: ipu-v3: ipu-ic: Fix saturation bit offset in TPMEM (bsc#1142635)
  • HID: Add 044f:b320 ThrustMaster, Inc. 2 in 1 DT (bsc#1051510).
  • HID: Add quirk for HP X1200 PIXART OEM mouse (bsc#1051510).
  • HID: cp2112: prevent sleeping function called from invalid context (bsc#1051510).
  • HID: hiddev: avoid opening a disconnected device (bsc#1051510).
  • HID: hiddev: do cleanup in failure of opening a device (bsc#1051510).
  • HID: holtek: test for sanity of intfdata (bsc#1051510).
  • HID: input: fix a4tech horizontal wheel custom usage (bsc#1137429).
  • HID: logitech-hidpp: change low battery level threshold from 31 to 30 percent (bsc#1051510).
  • HID: logitech-hidpp: use RAP instead of FAP to get the protocol version (bsc#1051510).
  • HID: sony: Fix race condition between rumble and device remove (bsc#1051510).
  • HID: wacom: Add ability to provide explicit battery status info (bsc#1051510).
  • HID: wacom: Add support for 3rd generation Intuos BT (bsc#1051510).
  • HID: wacom: Add support for Pro Pen slim (bsc#1051510).
  • HID: wacom: convert Wacom custom usages to standard HID usages (bsc#1051510).
  • HID: wacom: Correct button numbering 2nd-gen Intuos Pro over Bluetooth (bsc#1051510).
  • HID: wacom: Correct distance scale for 2nd-gen Intuos devices (bsc#1142635).
  • HID: wacom: correct misreported EKR ring values (bsc#1142635).
  • HID: wacom: correct touch resolution x/y typo (bsc#1051510).
  • HID: wacom: Do not report anything prior to the tool entering range (bsc#1051510).
  • HID: wacom: Do not set tool type until we're in range (bsc#1051510).
  • HID: wacom: fix bit shift for Cintiq Companion 2 (bsc#1051510).
  • HID: wacom: fix mistake in printk (bsc#1051510).
  • HID: wacom: generic: add the 'Report Valid' usage (bsc#1051510).
  • HID: wacom: generic: Correct pad syncing (bsc#1051510).
  • HID: wacom: generic: Ignore HIDDGBATTERYSTRENTH == 0 (bsc#1051510).
  • HID: wacom: generic: Leave tool in prox until it completely leaves sense (bsc#1051510).
  • HID: wacom: generic: only switch the mode on devices with LEDs (bsc#1051510).
  • HID: wacom: generic: read HIDDGCONTACTMAX from any feature report (bsc#1051510).
  • HID: wacom: generic: Refactor generic battery handling (bsc#1051510).
  • HID: wacom: generic: Report AES battery information (bsc#1051510).
  • HID: wacom: generic: Reset events back to zero when pen leaves (bsc#1051510).
  • HID: wacom: generic: Scale battery capacity measurements to percentages (bsc#1051510).
  • HID: wacom: generic: Send BTN_STYLUS3 when both barrel switches are set (bsc#1051510).
  • HID: wacom: generic: Send BTNTOOLPEN in prox once the pen enters range (bsc#1051510).
  • HID: wacom: generic: Support multiple tools per report (bsc#1051510).
  • HID: wacom: generic: Use generic codepath terminology in wacomwacpen_report (bsc#1051510).
  • HID: wacom: Mark expected switch fall-through (bsc#1051510).
  • HID: wacom: Move handling of HID quirks into a dedicated function (bsc#1051510).
  • HID: wacom: Move HID fix for AES serial number into wacomhidusage_quirk (bsc#1051510).
  • HID: wacom: Properly handle AES serial number and tool type (bsc#1051510).
  • HID: wacom: Queue events with missing type/serial data for later processing (bsc#1051510).
  • HID: wacom: Remove comparison of u8 mode with zero and simplify (bsc#1051510).
  • HID: wacom: Replace touchmax fixup code with static touchmax definitions (bsc#1051510).
  • HID: wacom: Send BTNTOUCH in response to INTUOSP2BT eraser contact (bsc#1051510).
  • HID: wacom: Support 'in range' for Intuos/Bamboo tablets where possible (bsc#1051510).
  • HID: Wacom: switch Dell canvas into highres mode (bsc#1051510).
  • HID: wacom: Sync INTUOSP2_BT touch state after each frame if necessary (bsc#1051510).
  • HID: wacom: wacomwaccollection() is local to wacom_wac.c (bsc#1051510).
  • HID: wacom: Work around HID descriptor bug in DTK-2451 and DTH-2452 (bsc#1051510).
  • hpet: Fix division by zero in hpettimediv() (bsc#1051510).
  • hugetlbfs: dirty pages as they are added to pagecache (git fixes (mm/hugetlbfs)).
  • hugetlbfs: fix kernel BUG at fs/hugetlbfs/inode.c:444! (git fixes (mm/hugetlbfs)).
  • hwmon: (core) add thermal sensors only if dev->of_node is present (bsc#1051510).
  • hwmon/coretemp: Cosmetic: Rename internal variables to zones from packages (jsc#SLE-5454).
  • hwmon/coretemp: Support multi-die/package (jsc#SLE-5454).
  • hwmon: (k10temp) 27C Offset needed for Threadripper2 ().
  • hwmon: (k10temp) Add Hygon Dhyana support ().
  • hwmon: (k10temp) Add support for AMD Ryzen w/ Vega graphics ().
  • hwmon: (k10temp) Add support for family 17h ().
  • hwmon: (k10temp) Add support for Stoney Ridge and Bristol Ridge CPUs ().
  • hwmon: (k10temp) Add support for temperature offsets ().
  • hwmon: (k10temp) Add temperature offset for Ryzen 1900X ().
  • hwmon: (k10temp) Add temperature offset for Ryzen 2700X ().
  • hwmon: (k10temp) Correct model name for Ryzen 1600X ().
  • hwmon: (k10temp) Display both Tctl and Tdie ().
  • hwmon: (k10temp) Fix reading critical temperature register ().
  • hwmon: (k10temp) Make function getrawtemp static ().
  • hwmon: (k10temp) Move chip specific code into probe function ().
  • hwmon: (k10temp) Only apply temperature offset if result is positive ().
  • hwmon: (k10temp) Support all Family 15h Model 6xh and Model 7xh processors ().
  • hwmon: k10temp: Support Threadripper 2920X, 2970WX; simplify offset table ().
  • hwmon: (k10temp) Use API function to access System Management Network ().
  • hwmon/k10temp, x86/amd_nb: Consolidate shared device IDs ().
  • hwmon: (lm75) Fix write operations for negative temperatures (bsc#1051510).
  • hwmon: (nct6775) Fix register address and added missed tolerance for nct6106 (bsc#1051510).
  • hwmon: (nct7802) Fix wrong detection of in4 presence (bsc#1051510).
  • hwmon: (pmbus/core) Treat parameters as paged if on multiple pages (bsc#1051510).
  • hwmon: (shtc1) fix shtc1 and shtw1 id mask (bsc#1051510).
  • hwrng: omap - Set default quality (bsc#1051510).
  • i2c: acorn: fix i2c warning (bsc#1135642).
  • i2c: dev: fix potential memory leak in i2cdevioctlrdwr (bsc#1051510).
  • i2c: emev2: avoid race when unregistering slave client (bsc#1051510).
  • i2c: i801: Add support for Intel Comet Lake (jsc#SLE-5331).
  • i2c-piix4: Add Hygon Dhyana SMBus support ().
  • i2c: piix4: Fix port selection for AMD Family 16h Model 30h (bsc#1051510).
  • i2c: qup: fixed releasing dma without flush operation completion (bsc#1051510).
  • IB/mlx5: Fix MR registration flow to use UMR properly (bsc#1093205 bsc#1145678).
  • ibmveth: Convert multicast list size for little-endian system (bsc#1061843).
  • ibmveth: Update ethtool settings to reflect virtual properties (bsc#1136157, LTC#177197).
  • ibmvnic: Add device identification to requested IRQs (bsc#1137739).
  • ibmvnic: Do not close unopened driver during reset (bsc#1137752).
  • ibmvnic: Do not process reset during or after device removal (bsc#1149652 ltc#179635).
  • ibmvnic: Fix unchecked return codes of memory allocations (bsc#1137752).
  • ibmvnic: Refresh device multicast list after reset (bsc#1137752).
  • ibmvnic: remove set but not used variable 'netdev' (bsc#1137739).
  • ibmvnic: Unmap DMA address of TX descriptor buffers after use (bsc#1146351 ltc#180726).
  • ife: error out when nla attributes are empty (networking-stable-190808).
  • igmp: fix memory leak in igmpv3deldelrec() (networking-stable-190725).
  • iio: adc: max9611: Fix misuse of GENMASK macro (bsc#1051510).
  • iio: adc: max9611: Fix temperature reading in probe (bsc#1051510).
  • iio: adsigmadelta: Properly handle SPI bus locking vs CS assertion (bsc#1051510).
  • iio: common: sspsensors: Initialize calculatedtime in sspcommonprocess_data (bsc#1051510).
  • iio: dac: ad5380: fix incorrect assignment to val (bsc#1051510).
  • iio: hmc5843: fix potential NULL pointer dereferences (bsc#1051510).
  • iio: iio-utils: Fix possible incorrect mask calculation (bsc#1051510).
  • Improve security, move default dialect to SMB3 from old CIFS (bsc#1051510, bsc#1144333).
  • include/linux/bitops.h: sanitize rotate primitives (git fixes).
  • indirect call wrappers: helpers to speed-up indirect calls of builtin (bsc#1124503).
  • Input: alps - do not handle ALPS cs19 trackpoint-only device (bsc#1051510).
  • Input: alps - fix a mismatch between a condition check and its comment (bsc#1051510).
  • Input: elan_i2c - remove Lenovo Legion Y7000 PnpID (bsc#1051510).
  • Input: elantech - enable middle button support on 2 ThinkPads (bsc#1051510).
  • Input: iforce - add sanity checks (bsc#1051510).
  • Input: imx_keypad - make sure keyboard can always wake up system (bsc#1051510).
  • Input: kbtab - sanity check for endpoint type (bsc#1051510).
  • Input: psmouse - fix build error of multiple definition (bsc#1051510).
  • Input: synaptics - enable RMI mode for HP Spectre X360 (bsc#1051510).
  • Input: synaptics - enable SMBUS on T480 thinkpad trackpad (bsc#1051510).
  • Input: synaptics - enable SMBus on ThinkPad E480 and E580 (bsc#1051510).
  • Input: synaptics - whitelist Lenovo T580 SMBus intertouch (bsc#1051510).
  • Input: tm2-touchkey - acknowledge that setting brightness is a blocking call (bsc#1129770).
  • Input: trackpoint - only expose supported controls for Elan, ALPS and NXP (bsc#1051510).
  • Input: uinput - add compat ioctl number translation for UIFFUPLOAD (bsc#1051510).
  • Install extra rpm scripts for kernel subpackaging (jsc#SLE-4117, jsc#SLE-3853, bsc#1128910).
  • intelth: msu: Fix single mode with disabled IOMMU (bsc#1051510).
  • intelth: pci: Add Ice Lake NNPI support (bsc#1051510).
  • intelth: pci: Add support for another Lewisburg PCH (bsc#1051510).
  • intelth: pci: Add Tiger Lake support (bsc#1051510).
  • iommu/amd: Add support for X2APIC IOMMU interrupts (bsc#1145010).
  • iommu/amd: Fix race in increaseaddressspace() (bsc#1150860).
  • iommu/amd: Flush old domains in kdump kernel (bsc#1150861).
  • iommu/amd: Make iommudisable safer (bsc#1140955).
  • iommu/amd: Move iommuinitpci() to .init section (bsc#1149105).
  • iommu/arm-smmu: Add support for qcom,smmu-v2 variant (bsc#1051510).
  • iommu/arm-smmu: Avoid constant zero in TLBI writes (bsc#1140956).
  • iommu/arm-smmu-v3: Abort all transactions if SMMU is enabled in kdump kernel (bsc#1117158).
  • iommu/arm-smmu-v3: Do not disable SMMU in kdump kernel (bsc#1117158 bsc#1134671).
  • iommu/arm-smmu-v3: sync the OVACKFLG to PRIQ consumer register (bsc#1051510).
  • iommu/arm-smmu-v3: Use explicit mb() when moving cons pointer (bsc#1051510).
  • iommu/dma: Fix for dereferencing before null checking (bsc#1151667).
  • iommu/dma: Handle SG length overflow better (bsc#1146084).
  • iommu: Fix a leak in iommuinsertresvregion (bsc#1140957).
  • iommu/iova: Avoid false sharing on fqtimeron (bsc#1151671).
  • iommu/iova: Fix compilation error with !CONFIGIOMMUIOVA (bsc#1145024).
  • iommu: Use right function to get group for device (bsc#1140958).
  • iommu/vt-d: Do not queueiova() if there is no flush queue (bsc#1145024).
  • iommu/vt-d: Duplicate iommuresvregion objects per device list (bsc#1140959).
  • iommu/vt-d: Handle PCI bridge RMRR device scopes in inteliommugetresvregions (bsc#1140960).
  • iommu/vt-d: Handle RMRR with PCI bridge device scopes (bsc#1140961).
  • iommu/vt-d: Introduce isdownstreamtopcibridge helper (bsc#1140962).
  • iommu/vt-d: Remove unnecessary rcureadlocks (bsc#1140964).
  • ip6tunnel: fix possible use-after-free on xmit (networking-stable-190808).
  • ipip: validate header length in ipiptunnelxmit (git-fixes).
  • ipv4: Define ipv4neighlookupnoref when CONFIGINET is disabled (git-fixes).
  • ipv4: do not set IPv6 only flags to IPv4 addresses (networking-stable-190725).
  • ipv4: Fix raw socket lookup for local traffic (networking-stable-190514).
  • ipv4/igmp: fix another memory leak in igmpv3deldelrec() (networking-stable-190531).
  • ipv4/igmp: fix build error if !CONFIGIPMULTICAST (networking-stable-190531).
  • ipv4: Use return value of inetiif() for _rawv4lookup in the while loop (git-fixes).
  • ipv6/addrconf: allow adding multicast addr if IFAFMCAUTOJOIN is set (networking-stable-190828).
  • ipv6: Consider skbounddevif when binding a raw socket to an address (networking-stable-190531).
  • ipv6: fix EFAULT on sendto with icmpv6 and hdrincl (networking-stable-190609).
  • ipv6: flowlabel: fl6socklookup() must use atomicincnotzero (networking-stable-190618).
  • ipv6: use READONCE() for inet->hdrincl as in ipv4 (networking-stable-190609).
  • irqchip/gic-v3-its: fix build warnings (bsc#1144880).
  • irqchip/gic-v3-its: fix some definitions of inner cacheability attributes (bsc#1051510).
  • irqchip/mbigen: Do not clear eventid when freeing an MSI (bsc#1051510).
  • isdn/capi: check message length in capiwrite() (bsc#1051510).
  • ISDN: hfcsusb: checking idx of ep configuration (bsc#1051510).
  • isdn: hfcsusb: Fix mISDN driver crash caused by transfer buffer on the stack (bsc#1051510).
  • isdn: mISDN: hfcsusb: Fix possible null-pointer dereferences in startisocchain() (bsc#1051510).
  • iwlwifi: dbg: split iwlfwerrordump to two functions (bsc#1119086).
  • iwlwifi: do not unmap as page memory that was mapped as single (bsc#1051510).
  • iwlwifi: fix bad dma handling in pagemem dumping flow (bsc#1120902).
  • iwlwifi: fw: use helper to determine whether to dump paging (bsc#1106434).
  • iwlwifi: mvm: check for length correctness in iwlmvmcreateskb() (bsc#1051510).
  • iwlwifi: mvm: do not send GEOTXPOWERLIMIT on version < 41 (bsc#1142635).
  • iwlwifi: mvm: fix an out-of-bound access (bsc#1051510).
  • iwlwifi: mvm: fix version check for GEOTXPOWERLIMIT support (bsc#1142635).
  • iwlwifi: pcie: do not crash on invalid RX interrupt (bsc#1051510).
  • iwlwifi: pcie: do not service an interrupt that was masked (bsc#1142635).
  • iwlwifi: pcie: fix ALIVE interrupt handling for gen2 devices w/o MSI-X (bsc#1142635).
  • jbd2: flushdescriptor(): Do not decrease buffer head's ref count (bsc#1143843).
  • jbd2: introduce jbd2inode dirty range scoping (bsc#1148616).
  • kabi: drop LINUXMIBTCPWQUEUETOOBIG snmp counter (bsc#1137586).
  • kabi: Fix kABI for 'struct amdiommu' (bsc#1145010).
  • kabi fixup blkmqregisterdev() (bsc#1140637).
  • kabi: media: em28xx: fix handler for vidiocsinput() (bsc#1051510). fixes kABI
  • kabi: media: em28xx: stop rewriting device's struct (bsc#1051510). fixes kABI
  • kabi workaround for the new pcidev.skipbuspm field addition (bsc#1051510).
  • kabi: x86/topology: Add CPUID.1F multi-die/package support (jsc#SLE-5454).
  • kabi: x86/topology: Define topologylogicaldieid() (jsc#SLE-5454).
  • kasan: remove redundant initialization of variable 'realsize' (git fixes).
  • kbuild: use -flive-patching when CONFIGLIVEPATCH is enabled (bsc#1071995).
  • kconfig/[mn]conf: handle backspace (^H) key (bsc#1051510).
  • kernel-binary: fix missing </li>
  • kernel-binary: rpm does not support multiline condition
  • kernel-binary: Use -c grep option in klp project detection.
  • kernel: jump label transformation performance (bsc#1137534 bsc#1137535 LTC#178058 LTC#178059).
  • kernel/signal.c: tracesignaldeliver when signalgroupexit (git-fixes).
  • keys: Fix missing null pointer check in requestkeyauthdescribe() (bsc#1051510).
  • KMPs: obsolete older KMPs of the same flavour (bsc#1127155, bsc#1109137).
  • KMPs: provide and conflict a kernel version specific KMP name (bsc#1127155, bsc#1109137).
  • kvm: arm64: Fix caching of host MDCREL2 value (bsc#1133021).
  • kvm: arm/arm64: Close VMID generation race (bsc#1133021).
  • kvm: arm/arm64: Convert kvmhostcpustate to a static per-cpu allocation (bsc#1133021).
  • kvm: arm/arm64: Drop resource size check for GICV window (bsc#1133021).
  • kvm: arm/arm64: Fix lost IRQs from emulated physcial timer when blocked (bsc#1133021).
  • kvm: arm/arm64: Fix VMID alloc race by reverting to lock-less (bsc#1133021).
  • kvm: arm/arm64: Handle CPUPMENTERFAILED (bsc#1133021).
  • kvm: arm/arm64: Reduce verbosity of KVM init log (bsc#1133021).
  • kvm: arm/arm64: Set dist->spis to NULL after kfree (bsc#1133021).
  • kvm: arm/arm64: Skip updating PMD entry if no change (bsc#1133021).
  • kvm: arm/arm64: Skip updating PTE entry if no change (bsc#1133021).
  • kvm: arm/arm64: vgic: Add missing irqlock to vgicmmioreadpending (bsc#1133021).
  • kvm: arm/arm64: vgic: Fix kvmdevice leak in vgicitsdestroy (bsc#1133021).
  • kvm: arm/arm64: vgic-its: Fix potential overrun in vgiccopylpilist (bsc#1133021).
  • kvm: arm/arm64: vgic-its: Take the srcu lock when parsing the memslots (bsc#1133021).
  • kvm: arm/arm64: vgic-its: Take the srcu lock when writing to guest memory (bsc#1133021).
  • kvm: arm/arm64: vgic-v3: Tighten synchronization for guests using v2 on v3 (bsc#1133021).
  • kvm: Disallow wraparound in kvmgfntohvacacheinit (bsc#1133021).
  • kvm/Eventfd: Avoid crash when assign and deassign specific eventfd in parallel (bsc#1133021).
  • kvm: Fix leak vCPU's VMCS value into other pCPU (bsc#1145388).
  • kvm: LAPIC: Fix pending interrupt in IRR blocked by software disable LAPIC (bsc#1145408).
  • kvm: mmu: Fix overflow on kvm mmu page limit calculation (bsc#1135335).
  • kvm: mmu: Fix overlap between public and private memslots (bsc#1133021).
  • kvm/mmu: kABI fix for *mmupages changes in struct kvmarch (bsc#1135335).
  • kvm: nVMX: allow setting the VMFUNC controls MSR (bsc#1145389).
  • kvm: nVMX: do not use dangling shadow VMCS after guest reset (bsc#1145390).
  • kvm: nVMX: Remove unnecessary syncroots from handleinvept (bsc#1145391).
  • kvm: nVMX: Use adjusted pin controls for vmcs02 (bsc#1145392).
  • kvm: polling: add architecture backend to disable polling (bsc#1119222).
  • kvm: PPC: Book3S: Fix incorrect guest-to-user-translation error handling (bsc#1061840).
  • kvm: PPC: Book3S HV: Avoid lockdep debugging in TCE realmode handlers (bsc#1061840).
  • kvm: PPC: Book3S HV: Check for MMU ready on piggybacked virtual cores (bsc#1061840).
  • kvm: PPC: Book3S HV: Do not lose pending doorbell request on migration on P9 (bsc#1061840).
  • kvm: PPC: Book3S HV: Do not push XIVE context when not using XIVE device (bsc#1061840).
  • kvm: PPC: Book3S HV: Fix CR0 setting in TM emulation (bsc#1061840).
  • kvm: PPC: Book3S HV: Fix lockdep warning when entering the guest (bsc#1061840).
  • kvm: PPC: Book3S HV: Fix race in re-enabling XIVE escalation interrupts (bsc#1061840).
  • kvm: PPC: Book3S HV: Handle virtual mode in XIVE VCPU push code (bsc#1061840).
  • kvm: PPC: Book3S HV: XIVE: Do not clear IRQ data of passthrough interrupts (bsc#1061840).
  • kvm: PPC: Book3S HV: XIVE: Free escalation interrupts before disabling the VP (bsc#1061840).
  • kvm: PPC: Book3S: Protect memslots while validating user address (bsc#1061840).
  • kvm: PPC: Release all hardware TCE tables attached to a group (bsc#1061840).
  • kvm: PPC: Remove redundand permission bits removal (bsc#1061840).
  • kvm: PPC: Validate all tces before updating tables (bsc#1061840).
  • kvm: PPC: Validate TCEs against preregistered memory page sizes (bsc#1061840).
  • kvm: Reject device ioctls from processes other than the VM's creator (bsc#1133021).
  • kvm: s390: change default halt poll time to 50us (bsc#1119222).
  • kvm: s390: enable CONFIGHAVEKVMNOPOLL (bsc#1119222) We need to enable CONFIGHAVEKVMNOPOLL for bsc#1119222
  • kvm: s390: fix typo in parameter description (bsc#1119222).
  • kvm: s390: kABI Workaround for 'lowcore' (bsc#1119222).
  • kvm: s390: provide kvmarchnopoll function (bsc#1119222).
  • kvm: svm/avic: Do not send AVIC doorbell to self (bsc#1140133).
  • kvm: svm/avic: fix off-by-one in checking host APIC ID (bsc#1140971).
  • kvm: SVM: Fix detection of AMD Errata 1096 (bsc#1142354).
  • kvm: VMX: Always signal #GP on WRMSR to MSRIA32CRPAT with bad value (bsc#1145393).
  • kvm: VMX: check CPUID before allowing read/write of IA32XSS (bsc#1145394).
  • kvm: VMX: Fix handling of #MC that occurs during VM-Entry (bsc#1145395).
  • kvm: x86: degrade WARN to prwarnratelimited (bsc#1145409).
  • kvm: x86: Do not update RIP or do single-step on faulting emulation (bsc#1149104).
  • kvm: x86: fix backward migration with asyncPF (bsc#1146074).
  • kvm: x86: fix return value for reserved EFER (bsc#1140992).
  • kvm: x86: Include CPUID leaf 0x8000001e in kvm's supported CPUID (bsc#1114279).
  • kvm: x86: Include multiple indices with CPUID leaf 0x8000001d (bsc#1114279).
  • kvm/x86: Move MSRIA32ARCHCAPABILITIES to array emulatedmsrs (bsc#1134881 bsc#1134882).
  • kvm: X86: Reduce the overhead when lapictimeradvance is disabled (bsc#1149083).
  • kvm: X86: Reduce the overhead when lapictimeradvance is disabled (bsc#1149083).
  • kvm: x86: Skip EFER vs. guest CPUID checks for host-initiated writes (bsc#1140972).
  • kvm: x86: Unconditionally enable irqs in guest context (bsc#1145396).
  • kvm: x86/vPMU: refine kvmpmu err msg when event creation failed (bsc#1145397).
  • lan78xx: Fix memory leaks (bsc#1051510).
  • lapb: fixed leak of control-blocks (networking-stable-190618).
  • leds: avoid flushwork in atomic context (bsc#1051510).
  • leds: leds-lp5562 allow firmware files up to the maximum length (bsc#1051510).
  • leds: trigger: gpio: GPIO 0 is valid (bsc#1051510).
  • libata: add SG safety checks in SFF pio transfers (bsc#1051510).
  • libata: do not request sense data on !ZAC ATA devices (bsc#1051510).
  • libata: Extend quirks for the ST1000LM024 drives with NOLPM quirk (bsc#1051510).
  • libata: have atascsirwxlat() fail invalid passthrough requests (bsc#1051510).
  • libata: zpodd: Fix small read overflow in zpoddgetmechtype() (bsc#1051510).
  • lib/bitmap.c: make bitmapparselist() thread-safe and much faster (bsc#1143507).
  • libceph: add osdreqopextentosddatabvecs() (bsc#1141450).
  • libceph: allow cephbufferput() to receive a NULL cephbuffer (bsc#1148133).
  • libceph: assign cookies in lingersubmit() (bsc#1135897).
  • libceph: check reply numdataitems in setuprequestdata() (bsc#1135897).
  • libceph: do not consume a ref on pagelist in cephmsgdataaddpagelist() (bsc#1135897).
  • libceph: enable fallback to cephmsgnew() in cephmsgpoolget() (bsc#1135897).
  • libceph: fix PG split vs OSD (re)connect race (bsc#1148133).
  • libceph: handle zero-length data items (bsc#1141450).
  • libceph: introduce allocwatchrequest() (bsc#1135897).
  • libceph: introduce BVECS data type (bsc#1141450).
  • libceph: introduce cephpagelistalloc() (bsc#1135897).
  • libceph: preallocate message data items (bsc#1135897).
  • libceph, rbd: add error handling for osdreqopclsinit() (bsc#1135897).
  • libceph, rbd, ceph: move cephosdcallocmessages() calls (bsc#1135897).
  • libceph, rbd: new bio handling code (aka do not clone bios) (bsc#1141450).
  • libceph: use single request data item for cmp/setxattr (bsc#1139101).
  • libertastf: Use correct channel range in lbtfgeoinit (bsc#1051510).
  • lib: fix stall in bitmapparselist() (bsc#1051510).
  • libiscsi: do not try to bypass SCSI EH (bsc#1142076).
  • libnvdimm/bus: Prevent duplicate deviceunregister() calls (bsc#1139865).
  • libnvdimm/namespace: Fix label tracking error (bsc#1142350).
  • libnvdimm, pfn: Fix over-trim in trimpfndevice() (bsc#1140719).
  • libnvdimm/pfn: Store correct value of npfns in namespace superblock (bsc#1146381 ltc#180720).
  • lib/scatterlist: Fix mapping iterator when sg->offset is greater than PAGESIZE (bsc#1051510).
  • liquidio: add cleanup in octeonsetupiq() (bsc#1051510).
  • livepatch: Nullify obj->mod in klpmodulecoming()'s error path (bsc#1071995).
  • livepatch: Remove duplicate warning about missing reliable stacktrace support (bsc#1071995).
  • livepatch: Use static buffer for debugging messages under rq lock (bsc#1071995).
  • llc: fix skb leak in llcbuildandsenduipkt() (networking-stable-190531).
  • loop: set PFMEMALLOCNOIO for the worker thread (git fixes).
  • mac80211/cfg80211: update bss channel on channel switch (bsc#1051510).
  • mac80211: Do not use stack memory with scatterlist for GMAC (bsc#1051510).
  • mac80211: do not warn about CW params when not using them (bsc#1051510).
  • mac80211: do not WARN on short WMM parameters from AP (bsc#1051510).
  • mac80211: drop robust management frames from unknown TA (bsc#1051510).
  • mac80211: Fix kernel panic due to use of txq after free (bsc#1051510).
  • mac80211: fix possible memory leak in ieee80211assignbeacon (bsc#1142635).
  • mac80211: fix possible sta leak (bsc#1051510).
  • mac80211: handle deauthentication/disassociation from TDLS peer (bsc#1051510).
  • mac80211: minstrelht: fix per-group max throughput rate initialization (bsc#1051510).
  • macsec: fix checksumming after decryption (bsc#1051510).
  • macsec: fix use-after-free of skb during RX (bsc#1051510).
  • macsec: let the administrator set UP state even if lowerdev is down (bsc#1051510).
  • macsec: update operstate when lower device changes (bsc#1051510).
  • mailbox: handle failed named mailbox channel request (bsc#1051510).
  • md: add mddev->pers to avoid potential NULL pointer dereference (git fixes).
  • md: do not report active arraystate until after revalidatedisk() completes (git-fixes).
  • md: only call setinsync() when it is expected to succeed (git-fixes).
  • md/raid6: Set R5ReadError when there is read failure on parity disk (git-fixes).
  • md/raid: raid5 preserve the writeback action after the parity check (git fixes).
  • media: atmel: atmel-isi: fix timeout value for stop streaming (bsc#1051510).
  • media: au0828: fix null dereference in error path (bsc#1051510).
  • media: au0828: Fix NULL pointer dereference in au0828analogstreamenable() (bsc#1051510).
  • media: au0828: stop video streaming only when last user stops (bsc#1051510).
  • media: coda: clear error return value before picture run (bsc#1051510).
  • media: coda: fix last buffer handling in V4L2ENCCMDSTOP (bsc#1051510).
  • media: coda: fix mpeg2 sequence number handling (bsc#1051510).
  • media: coda: increment sequence offset for the last returned frame (bsc#1051510).
  • media: coda: Remove unbalanced and unneeded mutex unlock (bsc#1051510).
  • media: cpia2: Fix use-after-free in cpia2exit (bsc#1051510).
  • media: cpia2usb: first wake up, then free in disconnect (bsc#1135642).
  • media: dib0700: fix link error for dibx000i2csetspeed (bsc#1051510).
  • media: dvb: usb: fix use after free in dvbusbdeviceexit (bsc#1051510).
  • media: em28xx: fix handler for vidiocsinput() (bsc#1051510).
  • media: em28xx: stop rewriting device's struct (bsc#1051510).
  • media: fdp1: Reduce FCP not found message level to debug (bsc#1051510).
  • media: go7007: avoid clang frame overflow warning with KASAN (bsc#1051510).
  • media: hdpvr: fix locking and a missing msleep (bsc#1051510).
  • media: m88ds3103: serialize reset messages in m88ds3103setfrontend (bsc#1051510).
  • media: marvell-ccic: do not generate EOF on parallel bus (bsc#1051510).
  • media: marvell-ccic: fix DMA s/g desc number calculation (bsc#1051510).
  • media: mc-device.c: do not memset _user pointer contents (bsc#1051510).
  • media: mediadeviceenumlinks32: clean a reserved field (bsc#1051510).
  • media: ov2659: make SFMT succeed even if requested format does not match (bsc#1051510).
  • media: ov6650: Fix sensor possibly not detected on probe (bsc#1051510).
  • media: ov6650: Move v4l2clkget() to ov6650videoprobe() helper (bsc#1051510).
  • media: pvrusb2: use a different format for warnings (bsc#1051510).
  • media: replace strcpy() by strscpy() (bsc#1051510).
  • media: Revert '[media] marvell-ccic: reset ccic phy when stop streaming for stability' (bsc#1051510).
  • media: s5p-mfc: Make additional clocks optional (bsc#1051510).
  • media: saa7146: avoid high stack usage with clang (bsc#1051510).
  • media: smsusb: better handle optional alignment (bsc#1051510).
  • media: spi: IR LED: add missing of table registration (bsc#1051510).
  • media: staging: media: davincivpfe: - Fix for memory leak if decoder initialization fails (bsc#1051510).
  • media: technisat-usb2: break out of loop at end of buffer (bsc#1051510).
  • media: tm6000: double free if usb disconnect while streaming (bsc#1051510).
  • media: usb: siano: Fix false-positive 'uninitialized variable' warning (bsc#1051510).
  • media: usb: siano: Fix general protection fault in smsusb (bsc#1051510).
  • media: v4l2-ioctl: clear fields in sparm (bsc#1051510).
  • media: v4l2: Test type instead of cfg->type in v4l2ctrlnewcustom() (bsc#1051510).
  • media: vb2: Fix videobuf2 to map correct area (bsc#1051510).
  • media: vivid: fix incorrect assignment operation when setting video mode (bsc#1051510).
  • media: vpss: fix a potential NULL pointer dereference (bsc#1051510).
  • media: wl128x: Fix some error handling in fmv4l2initvideodevice() (bsc#1051510).
  • mei: bus: need to unlink client before freeing (bsc#1051510).
  • mei: me: add denverton innovation engine device IDs (bsc#1051510).
  • mei: me: add gemini lake devices id (bsc#1051510).
  • memory: tegra: Fix integer overflow on tick value calculation (bsc#1051510).
  • memstick: Fix error cleanup path of memstickinit (bsc#1051510).
  • mfd: arizona: Fix undefined behavior (bsc#1051510).
  • mfd: core: Set fwnode for created devices (bsc#1051510).
  • mfd: da9063: Fix OTP control register names to match datasheets for DA9063/63L (bsc#1051510).
  • mfd: hi655x: Fix regmap area declared size for hi655x (bsc#1051510).
  • mfd: hi655x-pmic: Fix missing return value check for devmregmapinitmmioclk (bsc#1051510).
  • mfd: intel-lpss: Add Intel Comet Lake PCI IDs (jsc#SLE-4875).
  • mfd: intel-lpss: Release IDA resources (bsc#1051510).
  • mfd: intel-lpss: Set the device in reset state when init (bsc#1051510).
  • mfd: max77620: Fix swapped FPSPERIODMAXUS values (bsc#1051510).
  • mfd: tps65912-spi: Add missing of table registration (bsc#1051510).
  • mfd: twl6040: Fix device init errors for ACCCTL register (bsc#1051510).
  • mic: avoid statically declaring a 'struct device' (bsc#1051510).
  • mISDN: make sure device name is NUL terminated (bsc#1051510).
  • mm: add filemapfdatawaitrangekeeperrors() (bsc#1148616).
  • mmc: cavium: Add the missing dma unmap when the dma has finished (bsc#1051510).
  • mmc: cavium: Set the correct dma max segment size for mmchost (bsc#1051510).
  • mmc: core: Fix init of SD cards reporting an invalid VDD range (bsc#1051510).
  • mmc: core: make pwrseqemmc (partially) support sleepy GPIO controllers (bsc#1051510).
  • mmc: core: Prevent processing SDIO IRQs when the card is suspended (bsc#1051510).
  • mmc: core: Verify SD bus width (bsc#1051510).
  • mmc: dwmmc: Fix occasional hang after tuning on eMMC (bsc#1051510).
  • mmc: mmci: Prevent polling for busy detection in IRQ context (bsc#1051510).
  • mmc: sdhci-iproc: cygnus: Set NOHISPD bit to fix HS50 data hold time problem (bsc#1051510).
  • mmc: sdhci-iproc: Set NOHISPD bit to fix HS50 data hold time problem (bsc#1051510).
  • mmc: sdhci-msm: fix mutex while in spinlock (bsc#1142635).
  • mmc: sdhci-of-arasan: Do now show error message in case of deffered probe (bsc#1119086).
  • mmc: sdhci-of-at91: add quirk for broken HS200 (bsc#1051510).
  • mmc: sdhci-of-esdhc: add erratum A-009204 support (bsc#1051510).
  • mmc: sdhci-of-esdhc: add erratum eSDHC5 support (bsc#1051510).
  • mmc: sdhci-of-esdhc: add erratum eSDHC-A001 and A-008358 support (bsc#1051510).
  • mmc: sdhci-pci: Add support for Intel CML (jsc#SLE-4875).
  • mmc: sdhci-pci: Add support for Intel ICP (jsc#SLE-4875).
  • mmc: sdhci-pci: Try 'cd' for card-detect lookup before using NULL (bsc#1051510).
  • mmcspi: add a status check for spisynclocked (bsc#1051510).
  • mm: do not stall registershrinker() (bsc#1104902, VM Performance).
  • mm: Fix buggy backport leading to MAPSYNC failures (bsc#1137372)
  • mm/hmm: fix bad subpage pointer in trytounmapone (bsc#1148202, HMM, VM Functionality).
  • mm/hotplug: fix offline undoisolatepagerange() (bsc#1148196, VM Functionality).
  • mm/listlru.c: fix memory leak in _memcginitlistlrunode (bsc#1148379, VM Functionality).
  • mm/memcontrol.c: fix use after free in memcgroupiter() (bsc#1149224, VM Functionality).
  • mm/memory.c: recheck page table entry with page table lock held (bsc#1148363, VM Functionality).
  • mm/migrate.c: initialize pudentry in migratevma() (bsc#1148198, HMM, VM Functionality).
  • mm: migrate: Fix reference check race between findgetblock() and migration (bnc#1137609).
  • mm/mlock.c: change countmmmlockedpagenr return type (bsc#1148527, VM Functionality).
  • mm/mlock.c: mlockall error for flag MCLONFAULT (bsc#1148527, VM Functionality).
  • mm/nvdimm: add isioremapaddr and use that to check ioremap address (bsc#1140322 LTC#176270).
  • mm/pagealloc.c: fix calculation of pgdat->nrzones (bsc#1148192, VM Functionality).
  • mm, pagealloc: fix hasunmovablepages for HugePages (bsc#1127034).
  • mm: pagechage-limit: Calculate pagecache-limit based on node state (bsc#1136811)
  • mm: pagemapped: do not assume compound page is huge or THP (bsc#1148574, VM Functionality).
  • mm, pageowner: handle THP splits correctly (bsc#1149197, VM Debugging Functionality).
  • mm: replace all open encodings for NUMANONODE (bsc#1140322 LTC#176270).
  • mm: thp: relax GFPTHISNODE for MADVHUGEPAGE mappings (bnc#1012382).
  • mm/vmalloc: Sync unmappings in purgevmaparealazy() (bsc#1118689).
  • mm/vmscan.c: fix trying to reclaim unevictable LRU page (bsc#1149214, VM Functionality).
  • mm/vmscan.c: prevent useless kswapd loops (git fixes (mm/vmscan)).
  • module: Fix livepatch/ftrace module text permissions race (bsc#1071995).
  • mount: copy the port field into the cloned nfsserver structure (bsc#1136990).
  • move a few externs to smbdirect.h to eliminate warning (bsc#1144333).
  • move irqdatageteffectiveaffinitymask prior the sorted section
  • Move stuff gitsort chokes on, out of the way
  • Move upstreamed BT fix into sorted section
  • Move upstreamed nvme fix into sorted section
  • mpls: fix warning with multi-label encap (bsc#1051510).
  • mtd: spi-nor: Fix Cadence QSPI RCU Schedule Stall (bsc#1051510).
  • mvpp2: refactor MTU change code (networking-stable-190808).
  • mwifiex: Fix heap overflow in mwifiexuapparsetailies() (bsc#1136935).
  • mwifiex: Fix possible buffer overflows at parsing bss descriptor
  • nbd: replace killbdev() with _invalidatedevice() again (git fixes).
  • Negotiate and save preferred compression algorithms (bsc#1144333).
  • neighbor: Call ipv4neighlookupnoref in neighxmit (git-fixes).
  • neigh: fix use-after-free read in pneighgetnext (networking-stable-190618).
  • net/9p: include transcommon.h to fix missing prototype warning (bsc#1051510).
  • net/afiucv: remove GFPDMA restriction for HiperTransport (bsc#1142112 bsc#1142221 LTC#179334 LTC#179332).
  • net: avoid weird emergency message (networking-stable-190521).
  • net: bcmgenet: use promisc for unsupported filters (networking-stable-190725).
  • net: bridge: delete local fdb on device init failure (networking-stable-190808).
  • net: bridge: mcast: do not delete permanent entries when fast leave is enabled (networking-stable-190808).
  • net: bridge: mcast: fix stale ipv6 hdr pointer when handling v6 query (networking-stable-190725).
  • net: bridge: mcast: fix stale nsrcs pointer in igmp3/mld2 report handling (networking-stable-190725).
  • net: bridge: stp: do not cache eth dest pointer before skb pull (networking-stable-190725).
  • net: dsa: mv88e6xxx: wait after reset deactivation (networking-stable-190725).
  • net: ena: add ethtool function for changing io queue sizes (bsc#1139020 bsc#1139021).
  • net: ena: add good checksum counter (bsc#1139020 bsc#1139021).
  • net: ena: add handling of llq max tx burst size (bsc#1139020 bsc#1139021).
  • net: ena: add MAXQUEUESEXT get feature admin command (bsc#1139020 bsc#1139021).
  • net: ena: add newline at the end of prerr prints (bsc#1139020 bsc#1139021).
  • net: ena: add support for changing maxheadersize in LLQ mode (bsc#1139020 bsc#1139021).
  • net: ena: allow automatic fallback to polling mode (bsc#1139020 bsc#1139021).
  • net: ena: allow queue allocation backoff when low on memory (bsc#1139020 bsc#1139021).
  • net: ena: arrange enaprobe() function variables in reverse christmas tree (bsc#1139020 bsc#1139021).
  • net: ena: enable negotiating larger Rx ring size (bsc#1139020 bsc#1139021).
  • net: ena: ethtool: add extra properties retrieval via getprivflags (bsc#1139020 bsc#1139021).
  • net: ena: Fix bug where ring allocation backoff stopped too late (bsc#1139020 bsc#1139021).
  • net: ena: fix enacomfillhashfunction() implementation (bsc#1139020 bsc#1139021).
  • net: ena: fix: Free napi resources when enaup() fails (bsc#1139020 bsc#1139021).
  • net: ena: fix incorrect test of supported hash function (bsc#1139020 bsc#1139021).
  • net: ena: fix: set freed objects to NULL to avoid failing future allocations (bsc#1139020 bsc#1139021).
  • net: ena: fix swapped parameters when calling enacomindirecttablefillentry (bsc#1139020 bsc#1139021).
  • net: ena: gcc 8: fix compilation warning (bsc#1139020 bsc#1139021).
  • net: ena: improve latency by disabling adaptive interrupt moderation by default (bsc#1139020 bsc#1139021).
  • net: ena: make ethtool show correct current and max queue sizes (bsc#1139020 bsc#1139021).
  • net: ena: optimise calculations for CQ doorbell (bsc#1139020 bsc#1139021).
  • net: ena: remove inline keyword from functions in *.c (bsc#1139020 bsc#1139021).
  • net: ena: replace freetx/rxids union with single freeids field in enaring (bsc#1139020 bsc#1139021).
  • net: ena: update driver version from 2.0.3 to 2.1.0 (bsc#1139020 bsc#1139021).
  • net: ena: use devinfoonce instead of static variable (bsc#1139020 bsc#1139021).
  • net: fec: fix the clk mismatch in failedreset path (networking-stable-190531).
  • netfilter: conntrack: fix calculation of next bucket number in earlydrop (git-fixes).
  • net: fix ifindex collision during namespace removal (networking-stable-190808).
  • net: Fix netdevWARNONCE macro (git-fixes).
  • net-gro: fix use-after-free read in napigrofrags() (networking-stable-190531).
  • net/ibmvnic: Fix missing { in ibmvnicreset (bsc#1149652 ltc#179635).
  • net/ibmvnic: free reset work of removed device from queue (bsc#1149652 ltc#179635).
  • net/ibmvnic: prevent more than one thread from running in reset (bsc#1152457 ltc#174432).
  • net/ibmvnic: Remove tests of member address (bsc#1137739).
  • net/ibmvnic: unlock rtnllock in reset so linkwatchevent can run (bsc#1152457 ltc#174432).
  • net: Introduce netdevonce functions (networking-stable-190725).
  • net: make skbdstforce return true when dst is refcounted (networking-stable-190725).
  • net/mlx4core: Change the error print to info print (networking-stable-1905_21).
  • net/mlx4core: Zero out lkey field in SW2HWMPT fw command (bsc#1145678).
  • net/mlx4en: ethtool, Remove unsupported SFP EEPROM high pages query (networking-stable-1906_09).
  • net/mlx5: Allocate root ns memory using kzalloc to match kfree (networking-stable-190531).
  • net/mlx5: Avoid double free in fs init error unwinding path (networking-stable-190531).
  • net/mlx5e: IPoIB, Add error path in mlx5rdmasetuprn (networking-stable-1907_25).
  • net/mlx5e: Only support tx/rx pause setting for port owner (networking-stable-190821).
  • net/mlx5e: Prevent encap flow counter update async to user query (networking-stable-190808).
  • net/mlx5e: Use flow keys dissector to parse packets for ARFS (networking-stable-190821).
  • net/mlx5: Use reversed order when unregister devices (networking-stable-190808).
  • net: mvneta: Fix err code path of probe (networking-stable-190531).
  • net: mvpp2: fix bad MVPP2TXQSCHEDTOKENCNTRREG queue value (networking-stable-1905_31).
  • net: mvpp2: prs: Fix parser range for VID filtering (bsc#1098633).
  • net: mvpp2: prs: Use the correct helpers when removing all VID filters (bsc#1098633).
  • net: mvpp2: Use strscpy to handle stat strings (bsc#1098633).
  • net: neigh: fix multiple neigh timer scheduling (networking-stable-190725).
  • net: openvswitch: do not free vport if registernetdevice() is failed (networking-stable-1906_18).
  • net: openvswitch: fix csum updates for MPLS actions (networking-stable-190725).
  • net/packet: fix memory leak in packetsetring() (git-fixes).
  • net/packet: fix race in tpacketsnd() (networking-stable-1908_21).
  • net: rds: fix memory leak in rdsibflushmrpool (networking-stable-190609).
  • net: remove duplicate fetch in sockgetsockopt (networking-stable-1907_02).
  • netrom: fix a memory leak in nrrxframe() (networking-stable-190725).
  • netrom: hold sock when setting skb->destructor (networking-stable-190725).
  • net: sched: Fix a possible null-pointer dereference in dequeuefunc() (networking-stable-1908_08).
  • netsched: unset TCQFCANBYPASS when adding filters (networking-stable-190725).
  • net: sched: verify that q!=NULL before setting q->flags (git-fixes).
  • net: seeq: fix crash caused by not set dev.parent (networking-stable-190514).
  • net/smc: do not schedule txwork in SMCCLOSED state (bsc#1149963).
  • net/smc: make sure EPOLLOUT is raised (networking-stable-190828).
  • net/smc: original socket family in inetsockdiag (bsc#1149959).
  • net: stmmac: fixed new system time seconds value calculation (networking-stable-190702).
  • net: stmmac: fix reset gpio free missing (networking-stable-190531).
  • net: stmmac: set IC bit when transmitting frames with HW timestamp (networking-stable-190702).
  • net: unbreak CONFIG_RETPOLINE=n builds (bsc#1124503).
  • net: usb: pegasus: fix improper read if get_registers() fail (bsc#1051510).
  • net: usb: qmiwwan: add Telit 0x1260 and 0x1261 compositions (networking-stable-1905_21).
  • net: use indirect call wrappers at GRO network layer (bsc#1124503).
  • net: use indirect call wrappers at GRO transport layer (bsc#1124503).
  • nfc: fix potential illegal memory access (bsc#1051510).
  • nfit/ars: Allow root to busy-poll the ARS state machine (bsc#1140814).
  • nfit/ars: Avoid stale ARS results (jsc#SLE-5433).
  • nfit/ars: Introduce scrub_flags (jsc#SLE-5433).
  • nfs4: Fix v4.0 client state corruption when mount (git-fixes).
  • nfs add module option to limit NFSv4 minor version (jsc#PM-231).
  • nfs: Cleanup if nfsmatchclient is interrupted (bsc#1134291).
  • nfsd: degraded slot-count more gracefully as allocation nears exhaustion (bsc#1150381).
  • nfsd: Do not release the callback slot unless it was actually held (git-fixes).
  • nfsd: Fix overflow causing non-working mounts on 1 TB machines (bsc#1150381).
  • nfsd: fix performance-limiting session calculation (bsc#1150381).
  • nfsd: give out fewer session slots as limit approaches (bsc#1150381).
  • nfsd: handle drc over-allocation gracefully (bsc#1150381).
  • nfsd: increase DRC cache limit (bsc#1150381).
  • nfs: Do not interrupt file writeout due to fatal errors (git-fixes).
  • nfs: Do not open code clearing of delegation state (git-fixes).
  • nfs: Ensure O_DIRECT reports an error if the bytes read/written is 0 (git-fixes).
  • nfs: Fix a double unlock from nfsmatch,getclient (bsc#1134291).
  • nfs: Fix regression whereby fscache errors are appearing on 'nofsc' mounts (git-fixes).
  • nfs: Fix the inode request accounting when pages have subrequests (bsc#1140012).
  • nfs: Forbid setting AFINET6 to 'struct sockaddrin'->sin_family (git-fixes).
  • nfs: make nfsmatchclient killable (bsc#1134291).
  • nfs: Refactor nfslookuprevalidate() (git-fixes).
  • nfs: Remove redundant semicolon (git-fixes).
  • nfsv4.1: Again fix a race where CBNOTIFYLOCK fails to wake a waiter (git-fixes).
  • nfsv4.1: Fix open stateid recovery (git-fixes).
  • nfsv4.1: Only reap expired delegations (git-fixes).
  • nfsv4: Check the return value of updateopenstateid() (git-fixes).
  • nfsv4: Fix an Oops in nfs4dosetattr (git-fixes).
  • nfsv4: Fix a potential sleep while atomic in nfs4doreclaim() (git-fixes).
  • nfsv4: Fix delegation state recovery (git-fixes).
  • nfsv4: Fix lookup revalidate of regular files (git-fixes).
  • nfsv4: Fix OPEN / CLOSE race (git-fixes).
  • nfsv4: Handle the special Linux file open access mode (git-fixes).
  • nfsv4: Only pass the delegation to setattr if we're sending a truncate (git-fixes).
  • nfsv4/pnfs: Fix a page lock leak in nfspageioresend() (git-fixes).
  • nilfs2: do not use unexported cputole32()/le32tocpu() in uapi header (git fixes).
  • nl80211: Fix possible Spectre-v1 for CQM RSSI thresholds (bsc#1051510).
  • ntp: Allow TAI-UTC offset to be set to zero (bsc#1135642).
  • null_blk: complete requests from ->timeout (bsc#1149446).
  • null_blk: wire up timeouts (bsc#1149446).
  • nvme: cancel request synchronously (bsc#1145661).
  • nvme: change locking for the per-subsystem controller list (bsc#1142541).
  • nvme: copy MTFA field from identify controller (bsc#1140715).
  • nvme-core: Fix extra device_put() call on error path (bsc#1142541).
  • nvme-fc: fix module unloads while lports still pending (bsc#1150033).
  • nvme: fix memory leak caused by incorrect subsystem free (bsc#1143185).
  • nvme: fix multipath crash when ANA is deactivated (bsc#1149446).
  • nvme: fix possible use-after-free in connect error flow (bsc#1139500, bsc#1140426)
  • nvme: introduce NVMEQUIRKIGNOREDEVSUBNQN (bsc#1146938).
  • nvmem: allow to select i.MX nvmem driver for i.MX 7D (bsc#1051510).
  • nvmem: core: fix read buffer in place (bsc#1051510).
  • nvmem: correct Broadcom OTP controller driver writes (bsc#1051510).
  • nvmem: Do not let a NULL cellid for nvmemcell_get() crash us (bsc#1051510).
  • nvmem: imx-ocotp: Add i.MX7D timing write clock setup support (bsc#1051510).
  • nvmem: imx-ocotp: Add support for banked OTP addressing (bsc#1051510).
  • nvmem: imx-ocotp: Enable i.MX7D OTP write support (bsc#1051510).
  • nvmem: imx-ocotp: Move i.MX6 write clock setup to dedicated function (bsc#1051510).
  • nvmem: imx-ocotp: Pass parameters via a struct (bsc#1051510).
  • nvmem: imx-ocotp: Restrict OTP write to IMX6 processors (bsc#1051510).
  • nvmem: imx-ocotp: Update module description (bsc#1051510).
  • nvmem: properly handle returned value nvmemregread (bsc#1051510).
  • nvme-multipath: fix ana log nsid lookup when nsid is not found (bsc#1141554).
  • nvme-multipath: relax ANA state check (bsc#1123105).
  • nvme-multipath: revalidate nvmenshead gendisk in nvmevalidatens (bsc#1120876).
  • nvmem: Use the same permissions for eeprom as for nvmem (git-fixes).
  • nvme-rdma: Allow DELETING state change failure in (bsc#1104967,).
  • nvme-rdma: centralize admin/io queue teardown sequence (bsc#1142076).
  • nvme-rdma: centralize controller setup sequence (bsc#1142076).
  • nvme-rdma: fix a NULL deref when an admin connect times out (bsc#1149446).
  • nvme-rdma: fix double freeing of async event data (bsc#1120423).
  • nvme-rdma: fix possible double free of controller async event buffer (bsc#1120423).
  • nvme-rdma: fix possible free of a non-allocated async event buffer (bsc#1120423).
  • nvme-rdma: fix timeout handler (bsc#1149446).
  • nvme-rdma: stop admin queue before freeing it (bsc#1140155).
  • nvme-rdma: support up to 4 segments of inline data (bsc#1142076).
  • nvme-rdma: unquiesce queues when deleting the controller (bsc#1142076).
  • nvme: remove ns sibling before clearing path (bsc#1140155).
  • nvme: return BLKEHDONE from ->timeout (bsc#1142076).
  • nvme: Return BLKSTSTARGET if the DNR bit is set (bsc#1142076).
  • nvme: skip nvmeupdatedisk_info() if the controller is not live (bsc#1128432).
  • objtool: Add rewindstackdo_exit() to the noreturn list (bsc#1145302).
  • objtool: Support GCC 9 cold subfunction naming scheme (bsc#1145300).
  • ocfs2: add first lock wait time in locking_state (bsc#1134390).
  • ocfs2: add last unlock times in locking_state (bsc#1134390).
  • ocfs2: add locking filter debugfs file (bsc#1134390).
  • ocfs2: try to reuse extent block in dealloc without meta_alloc (bsc#1128902).
  • octeon_mgmt: Fix MIX registers configuration on MTU setup (bsc#1051510).
  • of: fix clang -Wunsequenced for be32tocpu() (bsc#1135642).
  • packet: Fix error path in packetinit (networking-stable-1905_14).
  • packet: in recvmsg msgname return at least sizeof sockaddrll (git-fixes).
  • parport: Fix mem leak in parportregisterdev_model (bsc#1051510).
  • PCI: Always allow probing with driver_override (bsc#1051510).
  • PCI: Do not poll for PME if the device is in D3cold (bsc#1051510).
  • PCI: hv: Add hvpciremove_slots() when we unload the driver (bsc#1142701).
  • PCI: hv: Add pcidestroyslot() in pcidevicespresent_work(), if necessary (bsc#1142701).
  • PCI: hv: Detect and fix Hyper-V PCI domain number collision (bsc#1150423).
  • PCI: hv: Fix a memory leak in hvejectdevice_work() (bsc#1142701).
  • PCI: hv: Fix a use-after-free bug in hvejectdevice_work() (bsc#1142701).
  • PCI: hv: Fix panic by calling hvpciremove_slots() earlier (bsc#1142701).
  • PCI: hv: Fix return value check in hvpciassign_slots() (bsc#1142701).
  • PCI: hv: Remove unused reason for refcount handler (bsc#1142701).
  • PCI: hv: support reporting serial number as slot information (bsc#1142701).
  • PCI: PM/ACPI: Refresh all stale power state data in pcipmcomplete() (bsc#1149106).
  • PCI: PM: Avoid possible suspend-to-idle issue (bsc#1051510).
  • PCI: PM: Skip devices in D0 for suspend-to-idle (bsc#1051510).
  • PCI: qcom: Ensure that PERST is asserted for at least 100 ms (bsc#1142635).
  • PCI: Restore Resizable BAR size bits correctly for 1MB BARs (bsc#1143841).
  • PCI: Return error if cannot probe VF (bsc#1051510).
  • PCI: rpadlpar: Fix leaked device_node references in add/remove paths (bsc#1051510).
  • PCI: xilinx-nwl: Fix Multi MSI data programming (bsc#1142635).
  • perf tools: Add Hygon Dhyana support ().
  • perf/x86/intel/cstate: Support multi-die/package (jsc#SLE-5454).
  • perf/x86/intel/rapl: Cosmetic rename internal variables in response to multi-die/pkg support (jsc#SLE-5454).
  • perf/x86/intel/rapl: Support multi-die/package (jsc#SLE-5454).
  • perf/x86/intel/uncore: Cosmetic renames in response to multi-die/pkg support (jsc#SLE-5454).
  • perf/x86/intel/uncore: Support multi-die/package (jsc#SLE-5454).
  • phy: qcom-qusb2: Fix crash if nvmem cell not specified (bsc#1051510).
  • phy: renesas: rcar-gen2: Fix memory leak at error paths (bsc#1051510).
  • phy: renesas: rcar-gen3-usb2: Disable clearing VBUS in over-current (bsc#1051510).
  • pinctrl: pistachio: fix leaked of_node references (bsc#1051510).
  • pinctrl: rockchip: fix leaked of_node references (bsc#1051510).
  • pkey: Indicate old mkvp only if old and current mkvp are different (bsc#1137827 LTC#178090).
  • pktgen: do not sleep with the thread lock held (git-fixes).
  • platform/chrome: crosecproto: check for NULL transfer function (bsc#1051510).
  • platform/x86: asus-nb-wmi: Support ALS on the Zenbook UX430UQ (bsc#1051510).
  • platform/x86: asus-wmi: Only Tell EC the OS will handle display hotkeys from asusnbwmi (bsc#1051510).
  • platform/x86: intelturbomax_3: Remove restriction for HWP platforms (jsc#SLE-5439).
  • platform/x86: mlx-platform: Fix parent device in i2c-mux-reg device registration (bsc#1051510).
  • platform/x86: pmcatom: Add CB4063 Beckhoff Automation board to critclksystems DMI table (bsc#1051510).
  • platform/x86: pmcatom: Add Siemens SIMATIC IPC227E to critclksystems DMI table (bsc#1051510).
  • PM / core: Propagate dev->power.wakeup_path when no callbacks (bsc#1051510).
  • PM / devfreq: rk3399_dmc: do not print error when get supply and clk defer (bsc#1144718,bsc#1144813).
  • PM / devfreq: rk3399_dmc: fix spelling mistakes (bsc#1144718,bsc#1144813).
  • PM / devfreq: rk3399_dmc: Pass ODT and auto power down parameters to TF-A (bsc#1144718,bsc#1144813).
  • PM / devfreq: rk3399_dmc: remove unneeded semicolon (bsc#1144718,bsc#1144813).
  • PM / devfreq: rk3399_dmc: remove wait for dcf irq event (bsc#1144718,bsc#1144813).
  • PM / devfreq: rockchip-dfi: Move GRF definitions to a common place (bsc#1144718,bsc#1144813).
  • PM / OPP: OF: Use prdebug() instead of prerr() while adding OPP table (jsc#SLE-7294).
  • PM: sleep: Fix possible overflow in pmsystemcancel_wakeup() (bsc#1051510).
  • pnfs fallback to MDS if no deviceid found (git-fixes).
  • pnfs/flexfiles: Fix PTRERR() dereferences in fflayouttrackds_error (git-fixes).
  • pnfs/flexfiles: Turn off soft RPC calls (git-fixes).
  • powercap/intelrapl: Simplify raplfind_package() (jsc#SLE-5454).
  • powercap/intel_rapl: Support multi-die/package (jsc#SLE-5454).
  • powercap/intel_rapl: Update RAPL domain name and debug messages (jsc#SLE-5454).
  • powerpc/64: Make sysswitchendian() traceable (bsc#1065729).
  • powerpc/64s: Include cpu header (bsc#1065729).
  • powerpc/64s/radix: Fix MADV_[FREE|DONTNEED] TLB flush miss problem with THP (bsc#1152161 ltc#181664).
  • powerpc/64s/radix: Fix memory hotplug section page table creation (bsc#1065729).
  • powerpc/64s/radix: Fix memory hot-unplug page table split (bsc#1065729).
  • powerpc/64s/radix: Implement tlbie(l)va_range flush functions (bsc#1152161 ltc#181664).
  • powerpc/64s/radix: Improve preempt handling in TLB code (bsc#1152161 ltc#181664).
  • powerpc/64s/radix: Improve TLB flushing for page table freeing (bsc#1152161 ltc#181664).
  • powerpc/64s/radix: Introduce local single page ceiling for TLB range flush (bsc#1055117 bsc#1152161 ltc#181664).
  • powerpc/64s/radix: Optimize flushtlbrange (bsc#1152161 ltc#181664).
  • powerpc/64s: Remove POWER9 DD1 support (bsc#1055117, LTC#159753, git-fixes).
  • powerpc/64s: support nospectre_v2 cmdline option (bsc#1131107).
  • powerpc: Allow flush(inval)dcache_range to work across ranges >4GB (bsc#1146575 ltc#180764).
  • powerpc: Always initialize input array when calling epapr_hypercall() (bsc#1065729).
  • powerpc/book3s/64: check for NULL pointer in pgd_alloc() (bsc#1078248, git-fixes).
  • powerpc/book3s64/mm: Do not do tlbie fixup for some hardware revisions (bsc#1152161 ltc#181664).
  • powerpc/book3s64/radix: Rename CPUFTRP9TLBIEBUG feature flag (bsc#1152161 ltc#181664).
  • powerpc: bpf: Fix generation of load/store DW instructions (bsc#1065729).
  • powerpc/bpf: use unsigned division instruction for 64-bit operations (bsc#1065729).
  • powerpc/cacheinfo: add cacheinfoteardown, cacheinforebuild (bsc#1138374, LTC#178199).
  • powerpc/crypto: Use cheaper random numbers for crc-vpmsum self-test ().
  • powerpc: Drop pageisram() and walksystemram_range() (bsc#1065729).
  • powerpc: dump kernel log before carrying out fadump or kdump (bsc#1149940 ltc#179958).
  • powerpc/eeh: Fix race with driver un/bind (bsc#1065729).
  • powerpc/fadump: Do not allow hot-remove memory from fadump reserved area (bsc#1120937).
  • powerpc/fadump: Reservationless firmware assisted dump (bsc#1120937).
  • powerpc/fadump: Throw proper error message on fadump registration failure (bsc#1120937).
  • powerpc/fadump: use kstrtoint to handle sysfs store (bsc#1146376).
  • powerpc/fadump: when fadump is supported register the fadump sysfs files (bsc#1146352).
  • powerpc: Fix HMIs on big-endian with CONFIG_RELOCATABLE=y (bsc#1065729).
  • powerpc/fsl: Add nospectre_v2 command line argument (bsc#1131107).
  • powerpc/fsl: Update Spectre v2 reporting (bsc#1131107).
  • powerpc/irq: Do not WARN continuously in archlocalirq_restore() (bsc#1065729).
  • powerpc/irq: drop archearlyirq_init() (bsc#1065729).
  • powerpc/kdump: Handle crashkernel memory reservation failure (bsc#1143466 LTC#179600).
  • powerpc/lib: Fix feature fixup test of external branch (bsc#1065729).
  • powerpc/mm: Change function prototype (bsc#1055117).
  • powerpc/mm: Consolidate numaenable check and mincommon_depth check (bsc#1140322 LTC#176270).
  • powerpc/mm/drconf: Use NUMANONODE on failures instead of node 0 (bsc#1140322 LTC#176270).
  • powerpc/mm: Fix node look up with numa=off boot (bsc#1140322 LTC#176270).
  • powerpc/mm: Fixup tlbie vs mtpidr/mtlpidr ordering issue on POWER9 (bsc#1152161 ltc#181664).
  • powerpc/mm: Handle page table allocation failures (bsc#1065729).
  • powerpc/mm/hash/4k: Do not use 64K page size for vmemmap with 4K pagesize (bsc#1142685 LTC#179509).
  • powerpc/mm/hugetlb: Update hugeptepsetaccessflags to call _ptepsetaccessflags directly (bsc#1055117).
  • powerpc/mm/radix: Change pte relax sequence to handle nest MMU hang (bsc#1055117).
  • powerpc/mm/radix: Drop unneeded NULL check (bsc#1152161 ltc#181664).
  • powerpc/mm/radix: implement LPID based TLB flushes to be used by KVM (bsc#1152161 ltc#181664).
  • powerpc/mm/radix: Move function from radix.h to pgtable-radix.c (bsc#1055117).
  • powerpc/mm/radix: Use the right page size for vmemmap mapping (bsc#1055117 bsc#1142685 LTC#179509).
  • powerpc/mm: Simplify pageisram by using memblockismemory (bsc#1065729).
  • powerpc/mm: Use memblock API for PPC32 pageisram (bsc#1065729).
  • powerpc/module64: Fix comment in RPPC64ENTRY handling (bsc#1065729).
  • powerpc/msi: Fix NULL pointer access in teardown code (bsc#1065729).
  • powerpc/perf: Add constraints for power9 l2/l3 bus events (bsc#1056686).
  • powerpc/perf: Add mem access events to sysfs (bsc#1124370).
  • powerpc/perf: Add PMLDMISSL1 and PMBR_2PATH to power9 event list (bsc#1137728, LTC#178106).
  • powerpc/perf: Add POWER9 alternate PMRUNCYC and PMRUNINST_CMPL events (bsc#1137728, LTC#178106).
  • powerpc/perf: Cleanup cache_sel bits comment (bsc#1056686).
  • powerpc/perf: Fix MMCRA corruption by bhrb_filter (bsc#1053043).
  • powerpc/perf: Fix thresholding counter data for unknown type (bsc#1056686).
  • powerpc/perf: Remove PMBRCMPL_ALT from power9 event list (bsc#1047238, bsc#1056686).
  • powerpc/perf: Update perf_regs structure to include SIER (bsc#1056686).
  • powerpc/powernv: Fix compile without CONFIG_TRACEPOINTS (bsc#1065729).
  • powerpc/powernv: Flush console before platform error reboot (bsc#1149940 ltc#179958).
  • powerpc/powernv/idle: Restore IAMR after idle (bsc#1065729).
  • powerpc/powernv/ioda2: Allocate TCE table levels on demand for default DMA window (bsc#1061840).
  • powerpc/powernv/ioda: Fix race in TCE level allocation (bsc#1061840).
  • powerpc/powernv: move OPAL call wrapper tracing and interrupt handling to C (bsc#1065729).
  • powerpc/powernv/npu: Remove obsolete comment about TCEKILLINVAL_ALL (bsc#1065729).
  • powerpc/powernv/opal-dump : Use IRQ_HANDLED instead of numbers in interrupt handler (bsc#1065729).
  • powerpc/powernv: Return for invalid IMC domain (bsc1054914, git-fixes).
  • powerpc/powernv: Use kernel crash path for machine checks (bsc#1149940 ltc#179958).
  • powerpc/process: Fix sparse address space warnings (bsc#1065729).
  • powerpc/pseries: add missing cpumask.h include file (bsc#1065729).
  • powerpc/pseries: Call HBLOCKREMOVE when supported (bsc#1109158).
  • powerpc/pseries: correctly track irq state in default idle (bsc#1150727 ltc#178925).
  • powerpc/pseries: Fix cpuhotpluglock acquisition in resize_hpt() (bsc#1065729).
  • powerpc/pseries: Fix oops in hotplug memory notifier (bsc#1138375, LTC#178204).
  • powerpc/pseries: Fix xive=off command line (bsc#1085030, git-fixes).
  • powerpc/pseries/memory-hotplug: Fix return value type of findaaindex (bsc#1065729).
  • powerpc/pseries/mobility: prevent cpu hotplug during DT update (bsc#1138374, LTC#178199).
  • powerpc/pseries/mobility: rebuild cacheinfo hierarchy post-migration (bsc#1138374, LTC#178199).
  • powerpc/pseries, ps3: panic flush kernel messages before halting system (bsc#1149940 ltc#179958).
  • powerpc/pseries: Read TLB Block Invalidate Characteristics (bsc#1109158).
  • powerpc/ptrace: Simplify vr_get/set() to avoid GCC warning (bsc#1148868).
  • powerpc/rtas: retry when cpu offline races with suspend/migration (bsc#1140428, LTC#178808).
  • powerpc/rtas: use device model APIs and serialization during LPM (bsc#1144123 ltc#178840).
  • powerpc/security: Show powerpcsecurityfeatures in debugfs (bsc#1131107).
  • powerpc/watchpoint: Restore NV GPRs while returning from exception (bsc#1140945 bsc#1141401 bsc#1141402 bsc#1141452 bsc#1141453 bsc#1141454 LTC#178983 LTC#179191 LTC#179192 LTC#179193 LTC#179194 LTC#179195).
  • powerpc/xive: Fix bogus error code returned by OPAL (bsc#1065729).
  • powerpc/xive: Fix dump of XIVE interrupt under pseries (bsc#1142019).
  • powerpc/xive: Fix loop exit-condition in xivefindtargetinmask() (bsc#1085030, bsc#1145189, LTC#179762).
  • powerpc/xive: Implement getirqchipstate method for XIVE to fix shutdown race (bsc#1065729).
  • powerpc/xmon: Add a dump of all XIVE interrupts (bsc#1142019).
  • powerpc/xmon: Check for HV mode when dumping XIVE info from OPAL (bsc#1142019).
  • powerpc/xmon: Fix opcode being uninitialized in printinsnpowerpc (bsc#1065729).
  • power: reset: gpio-restart: Fix typo when gpio reset is not found (bsc#1051510).
  • power: supply: Init device wakeup after device_add() (bsc#1051510).
  • power: supply: max14656: fix potential use-before-alloc (bsc#1051510).
  • power: supply: sysfs: prevent endless uevent loop with CONFIGPOWERSUPPLY_DEBUG (bsc#1051510).
  • ppp: deflate: Fix possible crash in deflateinit (networking-stable-1905_21).
  • ppp: Fix memory leak in ppp_write (git-fixes).
  • ppp: mppe: Add softdep to arc4 (bsc#1088047).
  • printk: Do not lose last line in kmsg buffer dump (bsc#1152460).
  • printk: fix printk_time race (bsc#1152466).
  • printk/panic: Avoid deadlock in printk() after stopping CPUs by NMI (bsc#1148712).
  • ptrace: Fix ->ptracercred handling for PTRACETRACEME (git-fixes).
  • ptrace: restore smprmb() in _ptracemayaccess() (git-fixes).
  • pwm: stm32: Use 3 cells ->of_xlate() (bsc#1111666).
  • qede: fix write to free'd pointer error and double free of ptp (bsc#1051510).
  • qla2xxx: kABI fixes for v10.01.00.18-k (bsc#1123034 bsc#1131304 bsc#1127988).
  • qla2xxx: remove SGI SN2 support (bsc#1123034 bsc#1131304 bsc#1127988).
  • qlcnic: Avoid potential NULL pointer dereference (bsc#1051510).
  • qlge: Deduplicate lbqbufsize (bsc#1106061).
  • qlge: Deduplicate rx buffer queue management (bsc#1106061).
  • qlge: Factor out duplicated expression (bsc#1106061).
  • qlge: Fix dmasyncsingle calls (bsc#1106061).
  • qlge: Fix irq masking in INTx mode (bsc#1106061).
  • qlge: Refill empty buffer queues from wq (bsc#1106061).
  • qlge: Refill rx buffers up to multiple of 16 (bsc#1106061).
  • qlge: Remove bq_desc.maplen (bsc#1106061).
  • qlge: Remove irq_cnt (bsc#1106061).
  • qlge: Remove pagechunk.lastflag (bsc#1106061).
  • qlge: Remove qlge_bq.len & size (bsc#1106061).
  • qlge: Remove rxring.sbqbuf_size (bsc#1106061).
  • qlge: Remove rx_ring.type (bsc#1106061).
  • qlge: Remove useless dma synchronization calls (bsc#1106061).
  • qlge: Remove useless memset (bsc#1106061).
  • qlge: Replace memset with assignment (bsc#1106061).
  • qlge: Update buffer queue prod index despite oom (bsc#1106061).
  • qmi_wwan: add network device usage statistics for qmimux devices (bsc#1051510).
  • qmi_wwan: Add quirk for Quectel dynamic config (bsc#1051510).
  • qmi_wwan: add support for QMAP padding in the RX path (bsc#1051510).
  • qmi_wwan: avoid RCU stalls on device disconnect when in QMAP mode (bsc#1051510).
  • qmiwwan: extend permitted QMAP muxid value range (bsc#1051510).
  • qmi_wwan: Fix out-of-bounds read (bsc#1111666).
  • quota: fix wrong condition in isquotamodification() (bsc#1152026).
  • r8152: Set memory to all 0xFFs on failed reg reads (bsc#1051510).
  • rapidio: fix a NULL pointer dereference when create_workqueue() fails (bsc#1051510).
  • RAS/CEC: Convert the timer callback to a workqueue (bsc#1114279).
  • RAS/CEC: Fix binary search function (bsc#1114279).
  • rbd: do not (ab)use obj_req->pages for stat requests (bsc#1141450).
  • rbd: do not NULL out ->objrequest in rbdimgobjparentreadfull() (bsc#1141450).
  • rbd: get rid of imgreq->copyuppages (bsc#1141450).
  • rbd: move from raw pages to bvec data descriptors (bsc#1141450).
  • rbd: remove bio cloning helpers (bsc#1141450).
  • rbd: start enums at 1 instead of 0 (bsc#1141450).
  • rbd: use kmemcachezalloc() in rbdimgrequest_create() (bsc#1141450).
  • RDS: IB: fix 'passing zero to ERR_PTR()' warning (git-fixes).
  • regmap: fix bulk writes on paged registers (bsc#1051510).
  • regulator: lm363x: Fix off-by-one nvoltages for lm3632 ldovpos/ldo_vneg (bsc#1051510).
  • regulator: qcomspmi: Fix math of spmiregulatorsetvoltagetimesel (bsc#1051510).
  • regulator: s2mps11: Fix buck7 and buck8 wrong voltages (bsc#1051510).
  • Remove ifdef since SMB3 (and later) now STRONGLY preferred (bsc#1051510, bsc#1144333).
  • Replace the bluetooth fix with the upstream commit (bsc#1135556)
  • Revert 'ALSA: hda/realtek - Improve the headset mic for Acer Aspire laptops' (bsc#1051510).
  • Revert 'bcache: set CACHESETIODISABLE in bchcacheddeverror()' (bsc#1140652).
  • Revert 'Bluetooth: validate BLE connection interval updates' (bsc#1051510).
  • Revert 'cfg80211: fix processing world regdomain when non modular' (bsc#1051510).
  • Revert 'dm bufio: fix deadlock with loop device' (git fixes).
  • Revert 'Drop multiversion(kernel) from the KMP template ()' (bsc#1109137).
  • Revert 'e1000e: fix cyclic resets at link up with active tx' (bsc#1051510).
  • Revert 'HID: wacom: generic: Send BTNTOOLPEN in prox once the pen enters range' (bsc#1051510).
  • Revert i915 userptr page lock patch (bsc#1145051) This patch potentially causes a deadlock between kcompactd, as reported on 5.3-rc3.
  • Revert 'KMPs: obsolete older KMPs of the same flavour (bsc#1127155, bsc#1109137).'
  • Revert 'mwifiex: fix system hang problem after resume' (bsc#1051510).
  • Revert 'net: ena: ethtool: add extra properties retrieval via getprivflags' (bsc#1139020 bsc#1139021).
  • Revert patches.suse/0001-blk-wbt-Avoid-lock-contention-and-thundering-herd-is.patch (bsc#1141543) As we see stalls / crashes recently with the relevant code path, revert this patch tentatively.
  • Revert 'Revert 'Drop multiversion(kernel) from the KMP template ()'' This feature was requested for SLE15 but aws reverted in packaging and master.
  • Revert 'Revert 'KMPs: obsolete older KMPs of the same flavour (bsc#1127155, bsc#1109137).''
  • Revert 'Revert 'KMPs: provide and conflict a kernel version specific KMP name''
  • Revert 'Revert 'Revert 'Drop multiversion(kernel) from the KMP template ()'''
  • Revert 's390/jump_label: Use 'jdd' constraint on gcc9 (bsc#1138589).' This broke the build with older gcc instead.
  • Revert 'scsi: ncr5380: Increase register polling limit' (git-fixes).
  • Revert 'scsi: ufs: disable vccq if it's not needed by UFS device' (git-fixes).
  • Revert 'serial: 8250: Do not service RX FIFO if interrupts are disabled' (bsc#1051510).
  • Revert 'svm: Fix AVIC incomplete IPI emulation' (bsc#1140133).
  • rpm: Add arm64 dtb-allwinner subpackage 4.10 added arch/arm64/boot/dts/allwinner/.
  • rpm: Add arm64 dtb-zte subpackage 4.9 added arch/arm64/boot/dts/zte/.
  • rpm/kernel-binary.spec.in: Add back kernel-binary-base subpackage (jsc#SLE-3853).
  • rpm/kernel-binary.spec.in: Build livepatch support in SUSE release projects (bsc#1124167).
  • rpm/kernel-binary.spec.in: Enable missing modules check.
  • rpm/kernel-binary.spec.in: Enable missing modules check.
  • rpm/kernel-subpackage-build: handle arm kernel zImage.
  • rpm/kernel-subpackage-spec: only provide firmware actually present in subpackage.
  • rpm/package-descriptions: fix typo in kernel-azure
  • rpm/post.sh: correct typo in err msg (bsc#1137625)
  • rpmsg: added MODULEALIAS for rpmsgchar (bsc#1051510).
  • rpmsg: smd: do not use mananged resources for endpoints and channels (bsc#1051510).
  • rpmsg: smd: fix memory leak on channel create (bsc#1051510).
  • rsi: improve kernel thread handling to fix kernel panic (bsc#1051510).
  • rslib: Fix decoding of shortened codes (bsc#1051510).
  • rslib: Fix handling of of caller provided syndrome (bsc#1051510).
  • rtc: 88pm860x: prevent use-after-free on device remove (bsc#1051510).
  • rtc: do not reference bogus function pointer in kdoc (bsc#1051510).
  • rtc: pcf8523: do not return invalid date when battery is low (bsc#1051510).
  • rtlwifi: fix a potential NULL pointer dereference (bsc#1051510).
  • rtnetlink: always put IFLALINK for links with a link-netnsid (networking-stable-1905_21).
  • rxrpc: Fix send on a connected, but unbound socket (networking-stable-190725).
  • s390/cio: fix ccwdevicestart_timeout API (bsc#1142109 LTC#179339).
  • s390/dasd: fix endless loop after read unit address configuration (bsc#1144912 LTC#179907).
  • s390/dasd: fix using offset into zero size array error (bsc#1051510).
  • s390/jump_label: Use 'jdd' constraint on gcc9 (bsc#1138589).
  • s390/qdio: handle PENDING state for QEBSM devices (bsc#1142117 bsc#1142118 bsc#1142119 LTC#179329 LTC#179330 LTC#179331).
  • s390/qeth: avoid control IO completion stalls (bsc#1142109 LTC#179339).
  • s390/qeth: be drop monitor friendly (bsc#1142220 LTC#179335).
  • s390/qeth: cancel cmd on early error (bsc#1142109 LTC#179339).
  • s390/qeth: fix race when initializing the IP address table (bsc#1051510).
  • s390/qeth: fix request-side race during cmd IO timeout (bsc#1142109 LTC#179339).
  • s390/qeth: fix VLAN attribute in bridge_hostnotify udev event (bsc#1051510).
  • s390/qeth: release cmd buffer in error paths (bsc#1142109 LTC#179339).
  • s390/qeth: simplify reply object handling (bsc#1142109 LTC#179339).
  • s390/setup: fix early warning messages (bsc#1051510).
  • s390/virtio: handle find on invalid queue gracefully (bsc#1051510).
  • s390/vtime: steal time exponential moving average (bsc#1119222).
  • s390/zcrypt: Fix wrong dispatching for control domain CPRBs (bsc#1137811 LTC#178088).
  • samples, bpf: fix to change the buffer size for read() (bsc#1051510).
  • samples: mei: use /dev/mei0 instead of /dev/mei (bsc#1051510).
  • sbitmap: fix improper use of smpmbbeforeatomic() (bsc#1140658).
  • sched/fair: Do not free p->numa_faults with concurrent readers (bsc#1144920).
  • sched/fair: Use RCU accessors consistently for ->numa_group (bsc#1144920).
  • sched/topology: Improve load balancing on AMD EPYC (bsc#1137366).
  • scripts/checkstack.pl: Fix arm64 wrong or unknown architecture (bsc#1051510).
  • scripts/decode_stacktrace: only strip base path when a prefix of the path (bsc#1051510).
  • scripts/decodestacktrace.sh: prefix addr2line with $CROSSCOMPILE (bsc#1051510).
  • scripts/gdb: fix lx-version string output (bsc#1051510).
  • scripts/gitsort/gitsort.py:
  • scripts/gitsort/gitsort.py: add djbw/nvdimm nvdimm-pending.
  • scripts/gitsort/gitsort.py: Add mmots tree.
  • scripts/gitsort/gitsort.py: add nvdimm/libnvdimm-fixes
  • scsi: aacraid: Fix missing break in switch statement (git-fixes).
  • scsi: aacraid: Fix performance issue on logical drives (git-fixes).
  • scsi: aic94xx: fix an error code in aic94xx_init() (git-fixes).
  • scsi: aic94xx: fix module loading (git-fixes).
  • scsi: bfa: convert to strlcpy/strlcat (git-fixes).
  • scsi: bnx2fc: fix incorrect cast to u64 on shift operation (git-fixes).
  • scsi: bnx2fc: Fix NULL dereference in error handling (git-fixes).
  • scsi: core: add new RDAC LENOVO/DE_Series device (bsc#1132390).
  • scsi: core: Fix race on creating sense cache (git-fixes).
  • scsi: core: set result when the command cannot be dispatched (git-fixes).
  • scsi: core: Synchronize request queue PM status only on successful resume (git-fixes).
  • scsi: cxlflash: Mark expected switch fall-throughs (bsc#1148868).
  • scsi: cxlflash: Prevent deadlock when adapter probe fails (git-fixes).
  • scsi: esp_scsi: Track residual for PIO transfers (git-fixes) Also, mitigate kABI changes.
  • scsi: fas216: fix sense buffer initialization (git-fixes).
  • scsi: ibmvfc: fix WARN_ON during event pool release (bsc#1137458 LTC#178093).
  • scsi: isci: initialize shost fully before calling scsiaddhost() (git-fixes).
  • scsi: libfc: fix null pointer dereference on a null lport (git-fixes).
  • scsi: libsas: delete sas port if expander discover failed (git-fixes).
  • scsi: libsas: Fix rphy phy_identifier for PHYs with end devices attached (git-fixes).
  • scsi: mac_scsi: Fix pseudo DMA implementation, take 2 (git-fixes).
  • scsi: mac_scsi: Increase PIO/PDMA transfer length threshold (git-fixes).
  • scsi: megaraid: fix out-of-bound array accesses (git-fixes).
  • scsi: megaraid_sas: Fix calculation of target ID (git-fixes).
  • scsi: NCR5380: Always re-enable reselection interrupt (git-fixes).
  • scsi: qedf: Add debug information for unsolicited processing (bsc#1149976).
  • scsi: qedf: Add shutdown callback handler (bsc#1149976).
  • scsi: qedf: Add support for 20 Gbps speed (bsc#1149976).
  • scsi: qedf: Check both the FCF and fabric ID before servicing clear virtual link (bsc#1149976).
  • scsi: qedf: Check for link state before processing LL2 packets and send fipvlan retries (bsc#1149976).
  • scsi: qedf: Check for module unloading bit before processing link update AEN (bsc#1149976).
  • scsi: qedf: Decrease the LL2 MTU size to 2500 (bsc#1149976).
  • scsi: qedf: Fix race betwen fipvlan request and response path (bsc#1149976).
  • scsi: qedf: Initiator fails to re-login to switch after link down (bsc#1149976).
  • scsi: qedf: Print message during bailout conditions (bsc#1149976).
  • scsi: qedf: remove memset/memcpy to nfunc and use func instead (git-fixes).
  • scsi: qedf: remove set but not used variables (bsc#1149976).
  • scsi: qedf: Stop sending fipvlan request on unload (bsc#1149976).
  • scsi: qedf: Update module description string (bsc#1149976).
  • scsi: qedf: Update the driver version to 8.37.25.20 (bsc#1149976).
  • scsi: qedf: Update the version to 8.42.3.0 (bsc#1149976).
  • scsi: qedf: Use discovery list to traverse rports (bsc#1149976).
  • scsi: qedi: remove declaration of nvm_image from stack (git-fixes).
  • scsi: qla2xxx: Add 28xx flash primary/secondary status/image mechanism (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Add cleanup for PCI EEH recovery (bsc#1129424).
  • scsi: qla2xxx: Add Device ID for ISP28XX (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Add error handling for PLOGI ELS passthrough (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Add First Burst support for FC-NVMe devices (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Add fwattr and portno SysFS node (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Add new FW dump template entry types (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Add pci function reset support (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Add protection mask module parameters (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Add Serdes support for ISP28XX (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Add support for multiple fwdump templates/segments (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Add support for setting port speed (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Allow NVMe IO to resume with short cable pull (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: allow session delete to finish before create (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Always check the qla2x00waitforhbaonline() return value (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Avoid PCI IRQ affinity mapping when multiqueue is not supported (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: avoid printf format warning (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Avoid that Coverity complains about dereferencing a NULL rport pointer (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Avoid that lockdep complains about unsafe locking in tcmqla2xxxclose_session() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Avoid that qla2x00memfree() crashes if called twice (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Avoid that qltsendresp_ctio() corrupts memory (git-fixes).
  • scsi: qla2xxx: Capture FW dump on MPI heartbeat stop event (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Change abort waitloop from msleep to waitevent_timeout (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Change data_dsd into an array (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Change default ZIO threshold (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Change the return type of qla24xxreadflash_data() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Change the return type of qla2x00updatemsfdmiiocb() into void (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Check for FW started flag before aborting (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: check for kstrtol() failure (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Check for MB timeout while capturing ISP27/28xx FW dump (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Check secondary image if reading the primary image fails (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Check the PCI info string output buffer size (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Check the size of firmware data structures at compile time (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Cleanup fcport memory to prevent leak (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Cleanup redundant qla2x00abortall_cmds during unload (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Cleanups for NVRAM/Flash read/write path (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: cleanup trace buffer initialization (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Complain if a command is released that is owned by the firmware (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Complain if a mailbox command times out (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Complain if a soft reset fails (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Complain if parsing the version string fails (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Complain if sp->done() is not called from the completion path (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Complain if waiting for pending commands times out (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Complain loudly about reference count underflow (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Correct error handling during initialization failures (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Correction and improvement to fwdt processing (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Correctly report max/min supported speeds (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: deadlock by configfsdependitem (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Declare fourth qla2x00setmodel_info() argument const (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Declare local functions 'static' (bsc#1137444).
  • scsi: qla2xxx: Declare local symbols static (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Declare qla24xxbuildscsicrc2_iocbs() static (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Declare qla2x00findnewloopid() static (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Declare qlatgtcmd.cdb const (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Declare the fourth qldumpbuffer() argument const (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Disable T10-DIF feature with FC-NVMe during probe (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Do not corrupt vha->plogiacklist (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Downgrade driver to 10.01.00.19-k There are upstream bug reports against 10.01.00.19-k which haven't been resolved. Also the newer version failed to get a proper review. For time being it's better to got with the older version and do not introduce new bugs.
  • scsi: qla2xxx: Dual FCP-NVMe target port support (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Enable type checking for the SRB free and done callback functions (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix abort handling in tcmqla2xxxwrite_pending() (bsc#1140727).
  • scsi: qla2xxx: Fix abort timeout race condition (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix a format specifier (git-fixes).
  • scsi: qla2xxx: Fix an endian bug in fcpcmdiscorrupted() (git-fixes).
  • scsi: qla2xxx: Fix a NULL pointer dereference (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix a qla24xxenablemsix() error path (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix a race condition between aborting and completing a SCSI command (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix a recently introduced kernel warning (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix a small typo in qla_bsg.c (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix code indentation for qla27xxfwdtentry (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix comment alignment in qla_bsg.c (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix comment in MODULEPARMDESC in qla2xxx (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix device staying in blocked state (git-fixes).
  • scsi: qla2xxx: Fix different size DMA Alloc/Unmap (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix DMA error when the DIF sg buffer crosses 4GB boundary (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix DMA unmap leak (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix driver reload for ISP82xx (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix driver unload when FC-NVMe LUNs are connected (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix error handling in qltallocqfull_cmd() (git-fixes).
  • scsi: qla2xxx: fix error message on <qla2400 (bsc#1118139).
  • scsi: qla2xxx: Fix FC-AL connection target discovery (bsc#1094555).
  • scsi: qla2xxx: fix fcport null pointer access (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix flash read for Qlogic ISPs (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix formatting of pointer types (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix function argument descriptions (bsc#1118139).
  • scsi: qla2xxx: Fix fw dump corruption (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix fw options handle ehbusreset() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix gnl.l memory leak on adapter init failure (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix hang in fcport delete path (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix hardirq-unsafe locking (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix hardlockup in abort command during driver remove (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix incorrect region-size setting in optrom SYSFS routines (bsc#1140728).
  • scsi: qla2xxx: Fix kernel crash after disconnecting NVMe devices (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix LUN discovery if loop id is not assigned yet by firmware (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix memory corruption during hba reset test (bsc#1118139).
  • scsi: qla2xxx: Fix message indicating vectors used by driver (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix N2N link reset (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix N2N link up fail (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix N2N target discovery with Local loop (bsc#1094555).
  • scsi: qla2xxx: Fix Nport ID display value (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix NULL pointer crash due to stale CPUID (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix NVME cmd and LS cmd timeout race condition (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix NVMe port discovery after a short device port loss (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix panic from use after free in qla2x00asynctm_cmd (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix possible fcport null-pointer dereferences (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix premature timer expiration (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix qla24xxprocessbidir_cmd() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix race conditions in the code for aborting SCSI commands (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix read offset in qla24xxloadrisc_flash() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix Relogin to prevent modifying scan_state flag (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix routine qla27xxdump{mpi|ram}() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix session cleanup hang (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix session lookup in qltabortwork() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: fix spelling mistake 'alredy' -> 'already' (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: fix spelling mistake: 'existant' -> 'existent' (bsc#1118139).
  • scsi: qla2xxx: fix spelling mistake 'initializatin' -> 'initialization' (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix SRB allocation flag to avoid sleeping in IRQ context (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix stale mem access on driver unload (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix stale session (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix stuck login session (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix unbound sleep in fcport delete path (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix unload when NVMe devices are configured (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Fix use-after-free issues in qla2xxxqpairspfreedma() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: flush IO on chip reset or sess delete (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: fully convert to the generic DMA API (bsc#1137444).
  • scsi: qla2xxx: Further limit FLASH region write access from SysFS (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: fx00 copypaste typo (bsc#1118139).
  • scsi: qla2xxx: Improve Linux kernel coding style conformance (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Improve logging for scan thread (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Improve several kernel-doc headers (bsc#1137444).
  • scsi: qla2xxx: Include the <asm/unaligned.h> header file from qla_dsd.h (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Increase the maxsglsegments to 1024 (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Increase the size of the mailbox arrays from 4 to 8 (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Inline the qla2x00fcportevent_handler() function (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Insert spaces where required (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Introduce a switch/case statement in qltxmittm_rsp() (bsc#1137444).
  • scsi: qla2xxx: Introduce qla2x00elsdcmd2_free() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Introduce qla2xxxgetnext_handle() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Introduce the beidt and leidt data types for FC src/dst IDs (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Introduce the dsd32 and dsd64 data structures (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Introduce the function qla2xxxinitsp() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Leave a blank line after declarations (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Let the compiler check the type of the SCSI command context pointer (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Log the status code if a firmware command fails (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Make it explicit that ELS pass-through IOCBs use little endian (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Make qla24xxasyncabort_cmd() static (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Make qla2x00abortsrb() again decrease the sp reference count (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Make qla2x00memfree() easier to verify (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Make qla2x00processresponse_queue() easier to read (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Make qla2x00sysfswrite_nvram() easier to analyze (bsc#1137444).
  • scsi: qla2xxx: Make qlthandleabts_completion() more robust (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Make sure that aborted commands are freed (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Make sure that qlafx00ioctliosb_entry() initializes 'res' (bsc#1137444).
  • scsi: qla2xxx: Modify NVMe include directives (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Move debug messages before sending srb preventing panic (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: move IO flush to the front of NVME rport unregistration (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Move marker request behind QPair (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Move qla2x00clearloopid() from qlainline.h into qla_init.c (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Move qla2x00isreservedid() from qlainline.h into qla_init.c (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Move qla2x00setfcport_state() from a .h into a .c file (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Move qla2x00setreservedloopids() definition (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Move the <linux/io-64-nonatomic-lo-hi.h> include directive (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Move the portstatestr definition from a .h to a .c file (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: no need to check return value of debugfs_create functions (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: NULL check before some freeing functions is not needed (bsc#1137444).
  • scsi: qla2xxx: on session delete, return nvme cmd (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Optimize NPIV tear down process (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Pass little-endian values to the firmware (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Prevent memory leak for CT req/rsp allocation (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Prevent multiple ADISC commands per session (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Prevent SysFS access when chip is down (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: qla2x00allocfw_dump: set ha->eft (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Really fix qla2xxxehabort() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Reduce the number of casts in GID list code (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Reduce the number of forward declarations (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Reduce the scope of three local variables in qla2xxx_queuecommand() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Reject EH{abort|devicereset|target_request} (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove a comment that refers to the SCSI host lock (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove an include directive from qla_mr.c (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove a set-but-not-used variable (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove a set-but-not-used variable (bsc#1137444).
  • scsi: qla2xxx: Remove a superfluous forward declaration (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove a superfluous pointer check (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove dead code (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: remove double assignment in qla2x00updatefcport (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove FW default template (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove qlatgtcmd.datawork and qlatgtcmd.datawork_free (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove qlatgtcmd.released (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: remove redundant null check on pointer sess (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove set but not used variable 'ptr_dma' (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove superfluous stsentry casts (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove the fcport test from qlanvmeabortwork() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: remove the unused tcmqla2xxxcmdwq (bsc#1118139).
  • scsi: qla2xxx: Remove two arguments from qlafx00errorentry() (bsc#1137444).
  • scsi: qla2xxx: Remove two superfluous casts (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove two superfluous if-tests (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove two superfluous tests (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove unnecessary locking from the target code (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove unnecessary null check (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove unreachable code from qla83xxidclock() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove unused symbols (bsc#1118139).
  • scsi: qla2xxx: Remove useless set memory to zero use memset() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Remove WARNONONCE in qla2x00statuscontentry() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Replace vmalloc + memset with vzalloc (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Report invalid mailbox status codes (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Report the firmware status code if a mailbox command fails (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Reset the FCFASYNC{SENT|ACTIVE} flags (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Restore FAWWPN of Physical Port only for loop down (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Retry fabric Scan on IOCB queue full (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Rework key encoding in qltfindhostbydid() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Secure flash update support for ISP28XX (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Set remote port devloss timeout to 0 (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Set remove flag for all VP (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Set the qpair in SRB to NULL when SRB is released (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Set the responder mode if appropriate for ELS pass-through IOCBs (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Set the SCSI command result before calling the command done (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Silence fwdump template message (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Silence Successful ELS IOCB message (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Simplification of register address used in qlatmpl.c (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Simplify a debug statement (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Simplify conditional check again (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Simplify qla24xxabortspdone() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Simplify qla24xxasyncabortcmd() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Simplify qltlportdump() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Simplify qltsendtermimmnotif() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Skip FW dump on LOOP initialization error (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Split the qla2x00abortallcmds() function (bsc#1137444).
  • scsi: qla2xxx: Suppress a Coveritiy complaint about integer overflow (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Suppress multiple Coverity complaint about out-of-bounds accesses (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: target: Fix offline port handling and host reset handling (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Uninline qla2x00inittimer() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Unregister chrdev if module initialization fails (git-fixes).
  • scsi: qla2xxx: Unregister resources in the opposite order of the registration order (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Update driver version to 10.00.00.13-k (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Update driver version to 10.00.00.14-k (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Update driver version to 10.01.00.15-k (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Update driver version to 10.01.00.16-k (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Update driver version to 10.01.00.18-k (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Update driver version to 10.01.00.19-k (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Update driver version to 10.01.00.20-k (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Update flash read/write routine (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Update two source code comments (git-fixes).
  • scsi: qla2xxx: Use an on-stack completion in qla24xxcontrolvp() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Use ARRAYSIZE() in the definition of QLALASTSPEED (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Use common update-firmware-options routine for ISP27xx+ (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Use complete switch scan for RSCN events (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Use Correct index for Q-Pair array (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Use get/putunaligned where appropriate (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Use le64 instead of uint32t for sending DMA addresses to firmware (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: use lower32bits and upper32bits instead of reinventing them (bsc#1137444).
  • scsi: qla2xxx: Use memcpy() and strlcpy() instead of strcpy() and strncpy() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Use mutex protection during qla2x00sysfsreadfwdump() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Use %p for printing pointers (bsc#1118139).
  • scsi: qla2xxx: Use strlcpy() instead of strncpy() (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Use tabs instead of spaces for indentation (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Use tabs to indent code (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla2xxx: Verify locking assumptions at runtime (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: qla4xxx: avoid freeing unallocated dma memory (git-fixes).
  • scsi: raidattrs: fix unused variable warning (git-fixes).
  • scsi: scsidhalua: Fix possible null-ptr-deref (git-fixes).
  • scsi: scsidhrdac: zero cdb in sendmodeselect() (bsc#1149313).
  • scsi: scsitransportfc: nvme: display FC-NVMe port roles (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsi: sd: Defer spinning up drive while SANITIZE is in progress (git-fixes).
  • scsi: sd: Fix a race between closing an sd device and sd I/O (git-fixes).
  • scsi: sd: Fix cachetypestore() (git-fixes).
  • scsi: sd: Optimal I/O size should be a multiple of physical block size (git-fixes).
  • scsi: sd: Quiesce warning if device does not report optimal I/O size (git-fixes).
  • scsi: sd: use mempool for discard special page (git-fixes).
  • scsi: sdzbc: Fix potential memory leak (git-fixes).
  • scsi: smartpqi: unlock on error in pqisubmitraidrequestsynchronous() (git-fixes).
  • scsi: sr: Avoid that opening a CD-ROM hangs with runtime power management enabled (git-fixes).
  • scsi: target/iblock: Fix overrun in WRITE SAME emulation (bsc#1140424).
  • scsi: tcmqla2xxx: Minimize #include directives (bsc#1123034 bsc#1131304 bsc#1127988).
  • scsitransportfc: complete requests from ->timeout (bsc#1142076).
  • scsi: ufs: Avoid runtime suspend possibly being blocked forever (git-fixes).
  • scsi: ufs: Check that space was properly alloced in copyqueryresponse (git-fixes).
  • scsi: ufs: Fix NULL pointer dereference in ufshcdconfigvreghpm() (git-fixes).
  • scsi: ufs: Fix RXTERMINATIONFORCEENABLE define value (git-fixes).
  • scsi: ufs: fix wrong command type of UTRD for UFSHCI v2.1 (git-fixes).
  • scsi: use dmagetcachealignment() as minimum DMA alignment (git-fixes).
  • scsi: virtioscsi: do not send sc payload with tmfs (git-fixes).
  • scsi: vmwpscsi: Fix use-after-free in pvscsiqueuelck() (bsc#1135296).
  • scsi: zfcp: fix missing zfcpport reference put on -EBUSY from portremove (bsc#1051510).
  • scsi: zfcp: fix rport unblock if deleted SCSI devices on ScsiHost (bsc#1051510).
  • scsi: zfcp: fix scsieh host reset with portforced ERP for non-NPIV FCP devices (bsc#1051510).
  • scsi: zfcp: fix to prevent portremove with pure auto scan LUNs (only sdevs) (bsc#1051510).
  • sctp: change to hold sk after auth shkey is created successfully (networking-stable-190702).
  • sctp: fix the transport errorcount check (networking-stable-190821).
  • sctp: Free cookie before we memdup a new one (networking-stable-190618).
  • sctp: silence warns on sctpstreaminit allocations (bsc#1083710).
  • serial: 8250: Fix TX interrupt handling condition (bsc#1051510).
  • serial: sh-sci: disable DMA for uartconsole (bsc#1051510).
  • serial: uartps: Do not add a trailing semicolon to macro (bsc#1051510).
  • serial: uartps: Fix long line over 80 chars (bsc#1051510).
  • serial: uartps: Fix multiple line dereference (bsc#1051510).
  • serial: uartps: Remove useless return from cdnsuartpollputchar (bsc#1051510).
  • signal/cifs: Fix cifsputtcpsession to call sendsig instead of forcesig (bsc#1144333).
  • signal/ptrace: Do not leak unitialized kernel memory with PTRACEPEEKSIGINFO (git-fixes).
  • sis900: fix TX completion (bsc#1051510).
  • sky2: Disable MSI on ASUS P6T (bsc#1142496).
  • sky2: Disable MSI on yet another ASUS boards (P6Xxxx) (bsc#1051510).
  • slip: make slhcfree() silently accept an error pointer (bsc#1051510).
  • slip: slalloc(): remove unused parameter 'devt line' (bsc#1051510).
  • smb2: fix missing files in root share directory listing (bsc#1112907, bsc#1144333).
  • smb2: fix typo in definition of a few error flags (bsc#1144333).
  • smb2: fix uninitialized variable bug in smb2ioctlqueryinfo (bsc#1144333).
  • smb3.1.1: Add GCM crypto to the encrypt and decrypt functions (bsc#1144333).
  • smb3.1.1 dialect is no longer experimental (bsc#1051510, bsc#1144333).
  • smb311: Fix reconnect (bsc#1051510, bsc#1144333).
  • smb311: Improve checking of negotiate security contexts (bsc#1051510, bsc#1144333).
  • smb3.11: replace a 4 with server->vals->headerpreamblesize (bsc#1144333).
  • smb3: add additional ftrace entry points for entry/exit to cifs.ko (bsc#1144333).
  • smb3: add credits we receive from oplock/break PDUs (bsc#1144333).
  • smb3: add debug for unexpected mid cancellation (bsc#1144333).
  • smb3: Add debug message later in smb2/smb3 reconnect path (bsc#1144333).
  • smb3: add define for id for posix create context and corresponding struct (bsc#1144333).
  • smb3: Add defines for new negotiate contexts (bsc#1144333).
  • smb3: add dynamic trace point for queryinfoenter/done (bsc#1144333).
  • smb3: add dynamic trace point for smb3cmdenter (bsc#1144333).
  • smb3: add dynamic tracepoint for timeout waiting for credits (bsc#1144333).
  • smb3: add dynamic tracepoints for simple fallocate and zero range (bsc#1144333).
  • smb3: Add dynamic trace points for various compounded smb3 ops (bsc#1144333).
  • smb3: Add ftrace tracepoints for improved SMB3 debugging (bsc#1144333).
  • smb3: Add handling for different FSCTL access flags (bsc#1144333).
  • smb3: add missing read completion trace point (bsc#1144333).
  • smb3: add module alias for smb3 to cifs.ko (bsc#1144333).
  • smb3: add new mount option to retrieve mode from special ACE (bsc#1144333).
  • smb3: Add posix create context for smb3.11 posix mounts (bsc#1144333).
  • smb3: Add protocol structs for change notify support (bsc#1144333).
  • smb3: add reconnect tracepoints (bsc#1144333).
  • smb3: Add SMB3.1.1 GCM to negotiated crypto algorigthms (bsc#1144333).
  • smb3: add smb3.1.1 to default dialect list (bsc#1144333).
  • smb3: Add support for multidialect negotiate (SMB2.1 and later) (bsc#1051510, bsc#1144333).
  • smb3: add support for posix negotiate context (bsc#1144333).
  • smb3: add support for statfs for smb3.1.1 posix extensions (bsc#1144333).
  • smb3: add tracepoint for sending lease break responses to server (bsc#1144333).
  • smb3: add tracepoint for session expired or deleted (bsc#1144333).
  • smb3: add tracepoint for slow responses (bsc#1144333).
  • smb3: add trace point for tree connection (bsc#1144333).
  • smb3: add tracepoints for query dir (bsc#1144333).
  • smb3: Add tracepoints for read, write and querydir enter (bsc#1144333).
  • smb3: add tracepoints for smb2/smb3 open (bsc#1144333).
  • smb3: add tracepoint to catch cases where credit refund of failed op overlaps reconnect (bsc#1144333).
  • smb3: add way to control slow response threshold for logging and stats (bsc#1144333).
  • smb3: allow more detailed protocol info on open files for debugging (bsc#1144333).
  • smb3: Allow persistent handle timeout to be configurable on mount (bsc#1144333).
  • smb3: allow posix mount option to enable new SMB311 protocol extensions (bsc#1144333).
  • smb3: allow previous versions to be mounted with snapshot= mount parm (bsc#1144333).
  • smb3: Allow query of symlinks stored as reparse points (bsc#1144333).
  • smb3: Allow SMB3 FSCTL queries to be sent to server from tools (bsc#1144333).
  • smb3: allow stats which track session and share reconnects to be reset (bsc#1051510, bsc#1144333).
  • smb3: Backup intent flag missing for directory opens with backupuid mounts (bsc#1051510, bsc#1144333).
  • smb3: Backup intent flag missing from compounded ops (bsc#1144333).
  • smb3: check for and properly advertise directory lease support (bsc#1051510, bsc#1144333).
  • smb3 - clean up debug output displaying network interfaces (bsc#1144333).
  • smb3: Cleanup license mess (bsc#1144333).
  • smb3: Clean up query symlink when reparse point (bsc#1144333).
  • smb3: create smb3 equivalent alias for cifs pseudo-xattrs (bsc#1144333).
  • smb3: directory sync should not return an error (bsc#1051510, bsc#1144333).
  • smb3: display bytesread and byteswritten in smb3 stats (bsc#1144333).
  • smb3: display security information in /proc/fs/cifs/DebugData more accurately (bsc#1144333).
  • smb3: display session id in debug data (bsc#1144333).
  • smb3: display stats counters for number of slow commands (bsc#1144333).
  • smb3: display volume serial number for shares in /proc/fs/cifs/DebugData (bsc#1144333).
  • smb3: do not allow insecure cifs mounts when using smb3 (bsc#1144333).
  • smb3: do not attempt cifs operation in smb3 query info error path (bsc#1051510, bsc#1144333).
  • smb3: do not display confusing message on mount to Azure servers (bsc#1144333).
  • smb3: do not display empty interface list (bsc#1144333).
  • smb3: Do not ignore OSYNC/ODSYNC and ODIRECT flags (bsc#1085536, bsc#1144333).
  • smb3: do not request leases in symlink creation and query (bsc#1051510, bsc#1144333).
  • smb3: do not send compression info by default (bsc#1144333).
  • smb3: Do not send SMB3 SETINFO if nothing changed (bsc#1051510, bsc#1144333).
  • smb3: enumerating snapshots was leaving part of the data off end (bsc#1051510, bsc#1144333).
  • smb3: fill in statfs fsid and correct namelen (bsc#1112905, bsc#1144333).
  • smb3: Fix 3.11 encryption to Windows and handle encrypted smb3 tcon (bsc#1051510, bsc#1144333).
  • smb3: fix bytesread statistics (bsc#1144333).
  • smb3: fix corrupt path in subdirs on smb311 with posix (bsc#1144333).
  • smb3: Fix deadlock in validate negotiate hits reconnect (bsc#1144333).
  • smb3: Fix endian warning (bsc#1137884).
  • smb3: Fix endian warning (bsc#1144333, bsc#1137884).
  • smb3: Fix enumerating snapshots to Azure (bsc#1144333).
  • smb3: fix large reads on encrypted connections (bsc#1144333).
  • smb3: fix lease break problem introduced by compounding (bsc#1144333).
  • smb3: Fix length checking of SMB3.11 negotiate request (bsc#1051510, bsc#1144333).
  • smb3: fix minor debug output for CONFIGCIFSSTATS (bsc#1144333).
  • smb3: Fix mode on mkdir on smb311 mounts (bsc#1144333).
  • smb3: Fix potential memory leak when processing compound chain (bsc#1144333).
  • smb3: fix redundant opens on root (bsc#1144333).
  • smb3: fix reset of bytes read and written stats (bsc#1112906, bsc#1144333).
  • smb3: Fix rmdir compounding regression to strict servers (bsc#1144333).
  • smb3: Fix root directory when server returns inode number of zero (bsc#1051510, bsc#1144333).
  • smb3: Fix SMB3.1.1 guest mounts to Samba (bsc#1051510, bsc#1144333).
  • smb3: fix various xid leaks (bsc#1051510, bsc#1144333).
  • smb3: for kerberos mounts display the credential uid used (bsc#1144333).
  • smb3: handle new statx fields (bsc#1085536, bsc#1144333).
  • smb3: if maxcredits is specified then display it in /proc/mounts (bsc#1144333).
  • smb3: if server does not support posix do not allow posix mount option (bsc#1144333).
  • smb3: improve dynamic tracing of open and posix mkdir (bsc#1144333).
  • smb3: increase initial number of credits requested to allow write (bsc#1144333).
  • smb3: Kernel oops mounting a encryptData share with CONFIGDEBUGVIRTUAL (bsc#1144333).
  • smb3: Log at least once if tree connect fails during reconnect (bsc#1144333).
  • smb3: make default i/o size for smb3 mounts larger (bsc#1144333).
  • smb3: minor cleanup of compoundsendrecv (bsc#1144333).
  • smb3: minor debugging clarifications in rfc1001 len processing (bsc#1144333).
  • smb3: minor missing defines relating to reparse points (bsc#1144333).
  • smb3: missing defines and structs for reparse point handling (bsc#1144333).
  • smb3: note that smb3.11 posix extensions mount option is experimental (bsc#1144333).
  • smb3: Number of requests sent should be displayed for SMB3 not just CIFS (bsc#1144333).
  • smb3: on kerberos mount if server does not specify auth type use krb5 (bsc#1051510, bsc#1144333).
  • smb3: on reconnect set PreviousSessionId field (bsc#1112899, bsc#1144333).
  • smb3: optimize open to not send query file internal info (bsc#1144333).
  • smb3: passthru query info does not check for SMB3 FSCTL passthru (bsc#1144333).
  • smb3: print tree id in debugdata in proc to be able to help logging (bsc#1144333).
  • smb3: query inode number on open via create context (bsc#1144333).
  • smb3: remove noisy warning message on mount (bsc#1129664, bsc#1144333).
  • smb3: remove per-session operations from per-tree connection stats (bsc#1144333).
  • smb3: rename encryptionrequired to smb3encryptionrequired (bsc#1144333).
  • smb3: request more credits on normal (non-large read/write) ops (bsc#1144333).
  • smb3: request more credits on tree connect (bsc#1144333).
  • smb3: retry on STATUSINSUFFICIENTRESOURCES instead of failing write (bsc#1144333).
  • smb3: send backup intent on compounded query info (bsc#1144333).
  • smb3: send CAPDFS capability during session setup (bsc#1144333).
  • smb3: Send netname context during negotiate protocol (bsc#1144333).
  • smb3: show number of current open files in /proc/fs/cifs/Stats (bsc#1144333).
  • smb3: simplify code by removing CONFIGCIFSSMB311 (bsc#1051510, bsc#1144333).
  • smb3: smbdirect no longer experimental (bsc#1144333).
  • smb3: snapshot mounts are read-only and make sure info is displayable about the mount (bsc#1144333).
  • smb3: track the instance of each session for debugging (bsc#1144333).
  • smb3: Track total time spent on roundtrips for each SMB3 command (bsc#1144333).
  • smb3: trivial cleanup to smb2ops.c (bsc#1144333).
  • smb3: update comment to clarify enumerating snapshots (bsc#1144333).
  • smb3: update default requested iosize to 4MB from 1MB for recent dialects (bsc#1144333).
  • smb3: Update POSIX negotiate context with POSIX ctxt GUID (bsc#1144333).
  • smb3: Validate negotiate request must always be signed (bsc#1064597, bsc#1144333).
  • smb3: Warn user if trying to sign connection that authenticated as guest (bsc#1085536, bsc#1144333).
  • smbd: Make upper layer decide when to destroy the transport (bsc#1144333).
  • smb: fix leak of validate negotiate info response buffer (bsc#1064597, bsc#1144333).
  • smb: fix validate negotiate info uninitialised memory use (bsc#1064597, bsc#1144333).
  • smb: Validate negotiate (to protect against downgrade) even if signing off (bsc#1085536, bsc#1144333).
  • smpboot: Place the _percpu annotation correctly (git fixes).
  • soc: mediatek: pwrap: Zero initialize rdata in pwrapinitcipher (bsc#1051510).
  • soc: rockchip: power-domain: Add a sanity check on pd->numclks (bsc#1144718,bsc#1144813).
  • soc: rockchip: power-domain: use clkbulk APIs (bsc#1144718,bsc#1144813).
  • soc: rockchip: power-domain: Use ofclkgetparentcount() instead of open coding (bsc#1144718,bsc#1144813).
  • soc: rockchip: Set the proper PWM for rk3288 (bsc#1051510).
  • sound: fix a memory leak bug (bsc#1051510).
  • spi: bcm2835aux: fix corruptions for longer spi transfers (bsc#1051510).
  • spi: bcm2835aux: remove dangerous uncontrolled read of fifo (bsc#1051510).
  • spi: bcm2835aux: unifying code between polling and interrupt driven code (bsc#1051510).
  • spi: bitbang: Fix NULL pointer dereference in spiunregistermaster (bsc#1051510).
  • spi: Fix zero length xfer bug (bsc#1051510).
  • spi: pxa2xx: Add support for Intel Comet Lake (jsc#SLE-5331).
  • spi: pxa2xx: fix SCR (divisor) calculation (bsc#1051510).
  • spi: spi-fsl-spi: call spifinalizecurrentmessage() at the end (bsc#1051510).
  • spi : spi-topcliff-pch: Fix to handle empty DMA buffers (bsc#1051510).
  • spi: tegra114: reset controller on probe (bsc#1051510).
  • st21nfcaconnectivityeventreceived: null check the allocation (bsc#1051510).
  • staging: comedi: amplcpci230: fix null pointer deref on interrupt (bsc#1051510).
  • staging: comedi: dt282x: fix a null pointer deref on interrupt (bsc#1051510).
  • staging: comedi: dt3000: Fix rounding up of timer divisor (bsc#1051510).
  • staging: comedi: dt3000: Fix signed integer overflow 'divider * base' (bsc#1051510).
  • staging: comedi: nimiocommon: Fix divide-by-zero for DIO cmdtest (bsc#1051510).
  • staging:iio:ad7150: fix threshold mode config bit (bsc#1051510).
  • staging: rtl8712: reduce stack usage, again (bsc#1051510).
  • Staging: vc04services: Fix a couple error codes (bsc#1051510).
  • staging: vc04services: prevent integer overflow in createpagelist() (bsc#1051510).
  • staging: wlan-ng: fix adapter initialization failure (bsc#1051510).
  • stncihciconnectivityeventreceived: null check the allocation (bsc#1051510).
  • sunhv: Fix device naming inconsistency between sunhvconsole and sunhvreg (networking-stable-190618).
  • SUNRPC fix regression in umount of a secure mount (git-fixes).
  • SUNRPC: Handle connection breakages correctly in callstatus() (git-fixes).
  • SUNRPC/nfs: Fix return value for nfs4callbackcompound() (git-fixes).
  • supported.conf: Add missing modules (bsc#1066369).
  • supported.conf: Add missing modules (bsc#1066369).
  • supported.conf: Add raspberrypi-cpufreq (jsc#SLE-7294).
  • supported.conf: Remove duplicate drivers/ata/libahciplatform
  • supported.conf: Sort alphabetically, align comments.
  • supported.conf: Sort alphabetically, align comments.
  • svm: Add warning message for AVIC IPI invalid target (bsc#1140133).
  • svm: Fix AVIC incomplete IPI emulation (bsc#1140133).
  • sysctl: handle overflow in procgetlong (bsc#1051510).
  • tcp: add tcpminsndmss sysctl (bsc#1137586).
  • tcp: enforce tcpminsndmss in tcpmtuprobing() (bsc#1137586).
  • tcp: limit payload size of sacked skbs (bsc#1137586).
  • tcp: make sure EPOLLOUT wont be missed (networking-stable-190828).
  • tcp: reduce tcpfastretransalert() verbosity (git-fixes).
  • tcp: Reset bytesacked and bytesreceived when disconnecting (networking-stable-190725).
  • tcp: tcpfragment() should apply sane memory limits (bsc#1137586).
  • team: Add vlan tx offload to hwencfeatures (networking-stable-190821).
  • team: Always enable vlan tx offload (bsc#1051510).
  • testfirmware: fix a memory leak bug (bsc#1051510).
  • testfirmware: Use correct snprintf() limit (bsc#1135642).
  • thermal: rcargen3thermal: disable interrupt in .remove (bsc#1051510).
  • thermal/x86pkgtempthermal: Cosmetic: Rename internal variables to zones from packages (jsc#SLE-5454).
  • thermal/x86pkgtempthermal: Support multi-die/package (jsc#SLE-5454).
  • thunderbolt: Fix to check for kmemdup failure (bsc#1051510).
  • tipc: change to use registerpernetdevice (networking-stable-190702).
  • tipc: fix hanging clients using poll with EPOLLOUT flag (git-fixes).
  • tmpfs: fix link accounting when a tmpfile is linked in (bsc#1051510).
  • tmpfs: fix uninitialized return value in shmemlink (bsc#1051510).
  • tools/cpupower: Add Hygon Dhyana support ().
  • topology: Create corecpus and diecpus sysfs attributes (jsc#SLE-5454).
  • topology: Create packagecpus sysfs attribute (jsc#SLE-5454).
  • tpm: Fix off-by-one when reading binarybiosmeasurements (bsc#1082555).
  • tpm: Fix TPM 1.2 Shutdown sequence to prevent future TPM operations (bsc#1082555).
  • tpmtiscore: Set TPMCHIPFLAGIRQ before probing for interrupts (bsc#1082555).
  • tpm/tpmi2catmel: Return -E2BIG when the transfer is incomplete (bsc#1082555).
  • tpm: Unify the send callback behaviour (bsc#1082555).
  • tpm: vtpmproxy: Suppress error logging when in closed state (bsc#1082555).
  • tracing: Fix header include guards in trace event headers (bsc#1144474).
  • tracing/snapshot: Resize spare buffer if size changed (bsc#1140726).
  • Tree connect for SMB3.1.1 must be signed for non-encrypted shares (bsc#1051510, bsc#1144333).
  • treewide: Replace GPLv2 boilerplate/reference with SPDX - rule 231 (bsc#1144333).
  • treewide: Use DEVICEATTRWO (bsc#1137739).
  • Trim build dependencies of sample subpackage spec file (jsc#SLE-4117, jsc#SLE-3853, bsc#1128910).
  • tty: ipwireless: fix missing checks for ioremap (bsc#1051510).
  • tty/ldsem, locking/rwsem: Add missing ACQUIRE to readfailed sleep loop (bsc#1051510).
  • tty: max310x: Fix external crystal register setup (bsc#1051510).
  • tty: max310x: Fix invalid baudrate divisors calculator (bsc#1051510).
  • tty: rocket: fix incorrect forward declaration of 'rpinit()' (bsc#1051510).
  • tty: serialcore: Set port active bit in uartportactivate (bsc#1051510).
  • tty: serial: cpmuart - fix init when SMC is relocated (bsc#1051510).
  • tty/serial: digicolor: Fix digicolor-usart already registered warning (bsc#1051510).
  • tty: serial: msmserial: avoid system lockup condition (bsc#1051510).
  • tty: serial: msmserial: Fix XON/XOFF (bsc#1051510).
  • tty/vt: fix write/write race in ioctl(KDSKBSENT) handler (bsc#1051510).
  • tua6100: Avoid build warnings (bsc#1051510).
  • tuntap: synchronize through tfiles array instead of tun->numqueues (networking-stable-190514).
  • tun: wake up waitqueues after IFFUP is set (networking-stable-190702).
  • udf: Fix incorrect final NOTALLOCATED (hole) extent length (bsc#1148617).
  • udp: use indirect call wrappers for GRO socket lookup (bsc#1124503).
  • Update config files. (bsc#1145687) Add the following kernel config to ARM64: CONFIGACPIPCISLOT=y CONFIGHOTPLUGPCIACPI=y
  • Update config files. - CIFS: add CONFIGCIFSDEBUGKEYS to dump encryption keys (bsc#1144333).
  • Update config files. - cifs: allow disabling insecure dialects in the config (bsc#1144333).
  • Update config files. - CIFS: SMBD: Introduce kernel config option CONFIGCIFSSMBDIRECT (bsc#1144333).
  • Update config files for NFSv4.2 Enable NFSv4.2 support - jsc@PM-231 This requires a module parameter for NFSv4.2 to actually be available on SLE12 and SLE15-SP0
  • update internal version number for cifs.ko (bsc#1144333).
  • Update session and share information displayed for debugging SMB2/SMB3 (bsc#1144333).
  • Update version of cifs module (bsc#1144333).
  • usb: Add LPM quirk for Surface Dock GigE adapter (bsc#1051510).
  • usb: cdc-acm: make sure a refcount is taken early enough (bsc#1142635).
  • usb: CDC: fix sanity checks in CDC union parser (bsc#1142635).
  • usb: cdc-wdm: fix race between write and disconnect due to flag abuse (bsc#1051510).
  • usb: chipidea: udc: do not do hardware access if gadget has stopped (bsc#1051510).
  • usb: chipidea: udc: workaround for endpoint conflict issue (bsc#1135642).
  • usb: core: Add PM runtime calls to usbhcdplatformshutdown (bsc#1051510).
  • usb: core: Do not unbind interfaces following device reset failure (bsc#1051510).
  • usb: core: Fix races in character device registration and deregistraion (bsc#1051510).
  • usb: core: hub: Disable hub-initiated U1/U2 (bsc#1051510).
  • usb: dwc2: Fix DMA cache alignment issues (bsc#1051510).
  • usb: dwc2: host: Fix wMaxPacketSize handling (fix webcam regression) (bsc#1135642).
  • usb: Fix chipmunk-like voice when using Logitech C270 for recording audio (bsc#1051510).
  • usb: Fix slab-out-of-bounds write in usbgetbosdescriptor (bsc#1051510).
  • usb: gadget: composite: Clear 'suspended' on reset/disconnect (bsc#1051510).
  • usb: gadget: ether: Fix race between getherdisconnect and rxsubmit (bsc#1051510).
  • usb: gadget: fusb300udc: Fix memory leak of fusb300->ep[i] (bsc#1051510).
  • usb: gadget: udc: lpc32xx: allocate descriptor with GFPATOMIC (bsc#1051510).
  • usb: gadget: udc: renesasusb3: Fix sysfs interface of 'role' (bsc#1142635).
  • usb: Handle USB3 remote wakeup for LPM enabled devices correctly (bsc#1051510).
  • usb: host: fotg2: restart hcd after port reset (bsc#1051510).
  • usb: host: ohci: fix a race condition between shutdown and irq (bsc#1051510).
  • usb: host: xhci-rcar: Fix timeout in xhcisuspend() (bsc#1051510).
  • usb: host: xhci: rcar: Fix typo in compatible string matching (bsc#1051510).
  • usb: iowarrior: fix deadlock on disconnect (bsc#1051510).
  • usbip: usbiphost: fix BUG: sleeping function called from invalid context (bsc#1051510).
  • usbip: usbiphost: fix stubdev lock context imbalance regression (bsc#1051510).
  • usbnet: fix kernel crash after disconnect (bsc#1051510).
  • usbnet: ipheth: fix racing condition (bsc#1051510).
  • usb: pci-quirks: Correct AMD PLL quirk detection (bsc#1051510).
  • usb: rio500: fix memory leak in close after disconnect (bsc#1051510).
  • usb: rio500: refuse more than one device at a time (bsc#1051510).
  • usb: serial: fix initial-termios handling (bsc#1135642).
  • usb: serial: ftdisio: add ID for isodebug v1 (bsc#1051510).
  • usb: serial: option: add D-Link DWM-222 device ID (bsc#1051510).
  • usb: serial: option: Add Motorola modem UARTs (bsc#1051510).
  • usb: serial: option: add support for GosunCn ME3630 RNDIS mode (bsc#1051510).
  • usb: serial: option: add support for Simcom SIM7500/SIM7600 RNDIS mode (bsc#1051510).
  • usb: serial: option: Add support for ZTE MF871A (bsc#1051510).
  • usb: serial: option: add Telit 0x1260 and 0x1261 compositions (bsc#1051510).
  • usb: serial: option: add the BroadMobi BM818 card (bsc#1051510).
  • usb: serial: pl2303: add Allied Telesis VT-Kit3 (bsc#1051510).
  • usb: serial: pl2303: fix tranceiver suspend mode (bsc#1135642).
  • usb: sisusbvga: fix oops in error path of sisusbprobe (bsc#1051510).
  • usb-storage: Add new JMS567 revision to unusualdevs (bsc#1051510).
  • usb: storage: ums-realtek: Update module parameter description for autodelinken (bsc#1051510).
  • usb: storage: ums-realtek: Whitelist auto-delink support (bsc#1051510).
  • usb: usbcore: Fix slab-out-of-bounds bug during device reset (bsc#1051510).
  • usb: usbfs: fix double-free of usb memory upon submiturb error (bsc#1051510).
  • usb: usb-storage: Add new ID to ums-realtek (bsc#1051510).
  • usb: wusbcore: fix unbalanced get/put clusterid (bsc#1051510).
  • usb: xhci: avoid null pointer deref when bos field is NULL (bsc#1135642).
  • usb: yurex: Fix use-after-free in yurexdelete (bsc#1051510).
  • vfio: ccw: only free cp on final interrupt (bsc#1051510).
  • vfs: fix page locking deadlocks when deduping files (bsc#1148619).
  • video: hgafb: fix potential NULL pointer dereference (bsc#1051510).
  • video: imsttfb: fix potential NULL pointer dereferences (bsc#1051510).
  • video: ssd1307fb: Start page range at pageoffset (bsc#1113722)
  • virtioconsole: initialize vtermno value for ports (bsc#1051510).
  • vlan: disable SIOCSHWTSTAMP in container (bsc#1051510).
  • VMCI: Fix integer overflow in VMCI handle arrays (bsc#1051510).
  • VMCI: Release resource if the work is already queued (bsc#1051510).
  • vrf: make sure skb->data contains ip header to make routing (networking-stable-190725).
  • vrf: sit mtu should not be updated when vrf netdev is the link (networking-stable-190514).
  • vsock/virtio: free packets during the socket release (networking-stable-190521).
  • vsock/virtio: set SOCKDONE on peer shutdown (networking-stable-190618).
  • vxlan: trivial indenting fix (bsc#1051510).
  • vxlan: use be32 type for the param vni in vxlanfdbdelete (bsc#1051510).
  • w1: fix the resume command API (bsc#1051510).
  • watchdog: bcm2835wdt: Fix module autoload (bsc#1051510).
  • watchdog: core: fix null pointer dereference when releasing cdev (bsc#1051510).
  • watchdog: f71808ewdt: fix F81866 bit operation (bsc#1051510).
  • watchdog: fix compile time error of pretimeout governors (bsc#1051510).
  • watchdog: imx2wdt: Fix settimeout for big timeout values (bsc#1051510).
  • wil6210: fix potential out-of-bounds read (bsc#1051510).
  • wimax/i2400m: fix a memory leak bug (bsc#1051510).
  • x86/alternative: Init idealnops for Hygon Dhyana ().
  • x86/amdnb: Add support for Raven Ridge CPUs ().
  • x86/amdnb: Check vendor in AMD-only functions ().
  • x86/apic: Add Hygon Dhyana support ().
  • x86/boot: Fix memory leak in defaultgetsmpconfig() (bsc#1114279).
  • x86/bugs: Add Hygon Dhyana to the respective mitigation machinery ().
  • x86/CPU/AMD: Clear RDRAND CPUID bit on AMD family 15h/16h (bsc#1114279).
  • x86/CPU/AMD: Do not force the CPB cap when running under a hypervisor (bsc#1114279).
  • x86/cpu: Create Hygon Dhyana architecture support file ().
  • x86/cpufeatures: Carve out CQM features retrieval (jsc#SLE-5382).
  • x86/cpufeatures: Combine word 11 and 12 into a new scattered features word (jsc#SLE-5382).
  • x86/cpufeatures: Enumerate the new AVX512 BFLOAT16 instructions (jsc#SLE-5382).
  • x86/cpu: Get cache info and setup cache cpumap for Hygon Dhyana ().
  • x86/CPU/hygon: Fix physprocid calculation logic for multi-die processors ().
  • x86/cpu/mtrr: Support TOPMEM2 and get MTRR number ().
  • x86/entry/64/compat: Fix stack switching for XEN PV (bsc#1108382).
  • x86/events: Add Hygon Dhyana support to PMU infrastructure ().
  • x86/fpu: Add FPU state copying quirk to handle XRSTOR failure on Intel Skylake CPUs (bsc#1151955).
  • x86/kvm: Add Hygon Dhyana support to KVM ().
  • x86/mce: Add Hygon Dhyana support to the MCA infrastructure ().
  • x86/mce: Do not disable MCA banks when offlining a CPU on AMD ().
  • x86/mce: Fix machinecheckpoll() tests for error types (bsc#1114279).
  • x86/microcode, cpuhotplug: Add a microcode loader CPU hotplug callback (bsc#1114279).
  • x86/microcode: Fix microcode hotplug state (bsc#1114279).
  • x86/microcode: Fix the ancient deprecated microcode loading method (bsc#1114279).
  • x86/microcode: Fix the microcode load on CPU hotplug for real (bsc#1114279).
  • x86/mm: Check for pfn instead of page in vmallocsyncone() (bsc#1118689).
  • x86, mm: fix fast GUP with hyper-based TLB flushing (VM Functionality, bsc#1140903).
  • x86/mm/memencrypt: Disable all instrumentation for early SME setup (bsc#1114279).
  • x86/mm: Sync also unmappings in vmallocsyncall() (bsc#1118689).
  • x86/pci, x86/amdnb: Add Hygon Dhyana support to PCI and northbridge ().
  • x86/smpboot: Do not use BSP INIT delay and MWAIT to idle on Dhyana ().
  • x86/smpboot: Rename matchdie() to matchpkg() (jsc#SLE-5454).
  • x86/speculation: Allow guests to use SSBD even if host does not (bsc#1114279).
  • x86/speculation/mds: Apply more accurate check on hypervisor platform (bsc#1114279).
  • x86/speculation/mds: Revert CPU buffer clear on double fault exit (bsc#1114279).
  • x86/tls: Fix possible spectre-v1 in dogetthreadarea() (bsc#1114279).
  • x86/topology: Add CPUID.1F multi-die/package support (jsc#SLE-5454).
  • x86/topology: Create topologymaxdieperpackage() (jsc#SLE-5454).
  • x86/topology: Define topologydieid() (jsc#SLE-5454).
  • x86/topology: Define topologylogicaldieid() (jsc#SLE-5454).
  • x86/unwind: Add hardcoded ORC entry for NULL (bsc#1114279).
  • x86/unwind: Handle NULL pointer calls better in frame unwinder (bsc#1114279).
  • x86/xen: Add Hygon Dhyana support to Xen ().
  • xen: let allocxenballoonedpages() fail if not enough memory free (bsc#1142450 XSA-300).
  • xen/netback: Reset nrfrags before freeing skb (networking-stable-190821).
  • xen-netfront: do not assume skbuffhead list is empty in error handling (bsc#1065600).
  • xen/pciback: Do not disable PCICOMMAND on PCI device reset (bsc#1065600).
  • xen/swiotlb: fix condition for calling xendestroycontiguousregion() (bsc#1065600).
  • xfrm: Fix bucket count reported to userspace (bsc#1143300).
  • xfrm: Fix error return code in xfrmoutputone() (bsc#1143300).
  • xfrm: Fix NULL pointer dereference in xfrminput when skbdstforce clears the dstentry (bsc#1143300).
  • xfrm: Fix NULL pointer dereference when skbdstforce clears the dstentry (bsc#1143300).
  • xfs: do not clear imapvalid for a non-uptodate buffers (bsc#1138018).
  • xfs: do not crash on null attr fork xfsbmapiread (bsc#1148035).
  • xfs: do not look at buffer heads in xfsaddtoioend (bsc#1138013).
  • xfs: do not overflow xattr listent buffer (bsc#1143105).
  • xfs: do not set the page uptodate in xfswritepagemap (bsc#1138003).
  • xfs: do not trip over uninitialized buffer on extent read of corrupted inode (bsc#1149053).
  • xfs: do not use XFSBMAPIENTRIRE in xfsgetblocks (bsc#1137999).
  • xfs: do not use XFSBMAPIIGSTATE in xfsmapblocks (bsc#1138005).
  • xfs: dump transaction usage details on log reservation overrun (bsc#1145235).
  • xfs: eliminate duplicate icreate tx reservation functions (bsc#1145235).
  • xfs: eof trim writeback mapping as soon as it is cached (bsc#1138019).
  • xfs: fix missing ILOCK unlock when xfssetattrnonsize fails due to EDQUOT (bsc#1148032).
  • xfs: fix semicolon.cocci warnings (bsc#1145235).
  • xfs: fix smaxbytes overflow problems (bsc#1137996).
  • xfs: fix up agi unlinked list reservations (bsc#1145235).
  • xfs: include an allocfree res for inobt modifications (bsc#1145235).
  • xfs: include inobt buffers in ifree tx log reservation (bsc#1145235).
  • xfs: make xfswritepagemap extent map centric (bsc#1138009).
  • xfs: minor cleanup for xfsgetblocks (bsc#1138000).
  • xfs: move all writeback bufferhead manipulation into xfsmapatoffset (bsc#1138014).
  • xfs: print transaction log reservation on overrun (bsc#1145235).
  • xfs: refactor inode chunk alloc/free tx reservation (bsc#1145235).
  • xfs: refactor the tail of xfswritepagemap (bsc#1138016).
  • xfs: refactor xlogcilinsertitems() to facilitate transaction dump (bsc#1145235).
  • xfs: remove more ondisk directory corruption asserts (bsc#1148034).
  • xfs: remove the imapvalid flag (bsc#1138012).
  • xfs: remove unused parameter from xfswritepagemap (bsc#1137995).
  • xfs: remove XFSIOINVALID (bsc#1138017).
  • xfs: remove xfsmapcow (bsc#1138007).
  • xfs: remove xfsreflinkfindcowmapping (bsc#1138010).
  • xfs: remove xfsreflinktrimirectonextcow (bsc#1138006).
  • xfs: remove xfsstartpagewriteback (bsc#1138015).
  • xfs: rename the offset variable in xfswritepagemap (bsc#1138008).
  • xfs: separate shutdown from ticket reservation print helper (bsc#1145235).
  • xfs: simplify xfsmapblocks by using xfsiextlookupextent directly (bsc#1138011).
  • xfs: skip CoW writes past EOF when writeback races with truncate (bsc#1137998).
  • xfs: truncate transaction does not modify the inobt (bsc#1145235).
  • xfs: xfsreflinkconvertcow() memory allocation deadlock (bsc#1138002).
  • xhci: Convert xhcihandshake() to use readlpolltimeoutatomic() (bsc#1051510).
  • xhci: update bounce buffer with correct sg num (bsc#1051510).
  • xhci: Use %zu for printing size_t type (bsc#1051510).

References

Affected packages

SUSE:Linux Enterprise Real Time 12 SP4
kernel-rt

Package

Name
kernel-rt
Purl
pkg:rpm/suse/kernel-rt&distro=SUSE%20Linux%20Enterprise%20Real%20Time%2012%20SP4

Affected ranges

Type
ECOSYSTEM
Events
Introduced
0Unknown introduced version / All previous versions are affected
Fixed
4.12.14-8.6.1

Ecosystem specific

{
    "binaries": [
        {
            "kernel-syms-rt": "4.12.14-8.6.1",
            "kernel-source-rt": "4.12.14-8.6.1",
            "kernel-rt": "4.12.14-8.6.1",
            "gfs2-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt-base": "4.12.14-8.6.1",
            "dlm-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt_debug-devel": "4.12.14-8.6.1",
            "cluster-md-kmp-rt": "4.12.14-8.6.1",
            "ocfs2-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt-devel": "4.12.14-8.6.1",
            "kernel-devel-rt": "4.12.14-8.6.1"
        }
    ]
}

Database specific

source
"https://ftp.suse.com/pub/projects/security/osv/SUSE-SU-2019:2756-1.json"
kernel-rt_debug

Package

Name
kernel-rt_debug
Purl
pkg:rpm/suse/kernel-rt_debug&distro=SUSE%20Linux%20Enterprise%20Real%20Time%2012%20SP4

Affected ranges

Type
ECOSYSTEM
Events
Introduced
0Unknown introduced version / All previous versions are affected
Fixed
4.12.14-8.6.1

Ecosystem specific

{
    "binaries": [
        {
            "kernel-syms-rt": "4.12.14-8.6.1",
            "kernel-source-rt": "4.12.14-8.6.1",
            "kernel-rt": "4.12.14-8.6.1",
            "gfs2-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt-base": "4.12.14-8.6.1",
            "dlm-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt_debug-devel": "4.12.14-8.6.1",
            "cluster-md-kmp-rt": "4.12.14-8.6.1",
            "ocfs2-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt-devel": "4.12.14-8.6.1",
            "kernel-devel-rt": "4.12.14-8.6.1"
        }
    ]
}

Database specific

source
"https://ftp.suse.com/pub/projects/security/osv/SUSE-SU-2019:2756-1.json"
kernel-source-rt

Package

Name
kernel-source-rt
Purl
pkg:rpm/suse/kernel-source-rt&distro=SUSE%20Linux%20Enterprise%20Real%20Time%2012%20SP4

Affected ranges

Type
ECOSYSTEM
Events
Introduced
0Unknown introduced version / All previous versions are affected
Fixed
4.12.14-8.6.1

Ecosystem specific

{
    "binaries": [
        {
            "kernel-syms-rt": "4.12.14-8.6.1",
            "kernel-source-rt": "4.12.14-8.6.1",
            "kernel-rt": "4.12.14-8.6.1",
            "gfs2-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt-base": "4.12.14-8.6.1",
            "dlm-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt_debug-devel": "4.12.14-8.6.1",
            "cluster-md-kmp-rt": "4.12.14-8.6.1",
            "ocfs2-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt-devel": "4.12.14-8.6.1",
            "kernel-devel-rt": "4.12.14-8.6.1"
        }
    ]
}

Database specific

source
"https://ftp.suse.com/pub/projects/security/osv/SUSE-SU-2019:2756-1.json"
kernel-syms-rt

Package

Name
kernel-syms-rt
Purl
pkg:rpm/suse/kernel-syms-rt&distro=SUSE%20Linux%20Enterprise%20Real%20Time%2012%20SP4

Affected ranges

Type
ECOSYSTEM
Events
Introduced
0Unknown introduced version / All previous versions are affected
Fixed
4.12.14-8.6.1

Ecosystem specific

{
    "binaries": [
        {
            "kernel-syms-rt": "4.12.14-8.6.1",
            "kernel-source-rt": "4.12.14-8.6.1",
            "kernel-rt": "4.12.14-8.6.1",
            "gfs2-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt-base": "4.12.14-8.6.1",
            "dlm-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt_debug-devel": "4.12.14-8.6.1",
            "cluster-md-kmp-rt": "4.12.14-8.6.1",
            "ocfs2-kmp-rt": "4.12.14-8.6.1",
            "kernel-rt-devel": "4.12.14-8.6.1",
            "kernel-devel-rt": "4.12.14-8.6.1"
        }
    ]
}

Database specific

source
"https://ftp.suse.com/pub/projects/security/osv/SUSE-SU-2019:2756-1.json"